Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_027_H24 (493 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P39911|YPHF_BACSU Hypothetical protein yphF (ORF1) 36 0.043 sp|Q10487|YDFG_SCHPO Putative transporter C17C9.16c 30 4.0 sp|Q74IY4|Y1326_LACJO Hypothetical UPF0085 protein LJ1326 28 8.9 sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer ar... 28 8.9
>sp|P39911|YPHF_BACSU Hypothetical protein yphF (ORF1) Length = 244 Score = 36.2 bits (82), Expect = 0.043 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 2/57 (3%) Frame = -3 Query: 197 LILLRSKIHPNTGRSSLNSFPMQKQLVEKQHQISEFIRINRGIL--QDSLLNVSMYQ 33 ++ L ++PN +SS+++ P Q QL + Q + EF + N G+L Q ++ +YQ Sbjct: 13 VVFLSGCLYPNERKSSVHAIPYQDQLKQVQSAVDEFQKANGGLLPIQTKDMSTPLYQ 69
>sp|Q10487|YDFG_SCHPO Putative transporter C17C9.16c Length = 531 Score = 29.6 bits (65), Expect = 4.0 Identities = 18/59 (30%), Positives = 29/59 (49%) Frame = -1 Query: 463 PLYKELFFATA*SNKSSFRLLRVIFQYLSTNFQWILLSISAANLTFNTIKFAGSQTFDR 287 P+ LF+A+ SF L + +FQYL+ + + S+ A N F + A S + R Sbjct: 429 PIVGTLFYASG-----SFLLFQSMFQYLAAAYPKYVASVFAGNALFRSSMAAASPLYAR 482
>sp|Q74IY4|Y1326_LACJO Hypothetical UPF0085 protein LJ1326 Length = 280 Score = 28.5 bits (62), Expect = 8.9 Identities = 18/59 (30%), Positives = 32/59 (54%) Frame = +1 Query: 112 FSTNCFCIGKLFSELLPVFGCILLLNSINKTENVEINKFSNCNCYDYLIDLLAGTIVSI 288 F TN + K+FSE+ ++ I++ E + + KF+ + Y +DLL+G I +I Sbjct: 48 FITNREKLEKVFSEITEFENVLIAFTLIHEDEQLAVIKFAREHNMKY-VDLLSGVIDNI 105
>sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm (DHC alpha) Length = 4499 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 8/41 (19%) Frame = +2 Query: 329 CQICCRNR--------QQYPLEICRQVLENYSQESKRGFVR 427 C CC Q+ LEIC++ L +Y + +R F R Sbjct: 1412 CVSCCNREGLYANLETQERELEICKKALNDYMESKRRAFPR 1452
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,383,939 Number of Sequences: 369166 Number of extensions: 899462 Number of successful extensions: 2804 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2804 length of database: 68,354,980 effective HSP length: 102 effective length of database: 49,512,010 effective search space used: 3020232610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)