DrC_00751
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00751 (1050 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8ZR68|SYC_SALTY Cysteinyl-tRNA synthetase (Cysteine--tR... 33 1.8 sp|Q8Z8P6|SYC_SALTI Cysteinyl-tRNA synthetase (Cysteine--tR... 33 1.8 sp|Q5E4F1|SYC_VIBF1 Cysteinyl-tRNA synthetase (Cysteine--tR... 33 1.8 sp|Q87YQ2|SYC_PSESM Cysteinyl-tRNA synthetase (Cysteine--tR... 33 1.8 sp|P13816|GARP_PLAFF Glutamic acid-rich protein precursor 33 1.8 sp|P21888|SYC_ECOLI Cysteinyl-tRNA synthetase (Cysteine--tR... 32 2.3 sp|Q83M27|SYC_SHIFL Cysteinyl-tRNA synthetase (Cysteine--tR... 32 2.3 sp|Q9KQZ9|SYC_VIBCH Cysteinyl-tRNA synthetase (Cysteine--tR... 32 2.3 sp|Q8FK44|SYC_ECOL6 Cysteinyl-tRNA synthetase (Cysteine--tR... 32 2.3 sp|Q8XCT9|SYC_ECO57 Cysteinyl-tRNA synthetase (Cysteine--tR... 32 2.3
>sp|Q8ZR68|SYC_SALTY Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 32.7 bits (73), Expect = 1.8 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = -1 Query: 1038 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTS 883 ++ + ++ NFF RD LK Y RYFLM H RS N + + S Sbjct: 264 REKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQARAS 315
>sp|Q8Z8P6|SYC_SALTI Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) sp|Q5PCE2|SYC_SALPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 32.7 bits (73), Expect = 1.8 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = -1 Query: 1038 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTS 883 ++ + ++ NFF RD LK Y RYFLM H RS N + + S Sbjct: 264 REKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQARAS 315
>sp|Q5E4F1|SYC_VIBF1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 32.7 bits (73), Expect = 1.8 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = -1 Query: 1038 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTS 883 ++ + ++ NFF RD L Y RYFLM H RS N + N+ S Sbjct: 266 REKMSKSLGNFFTIRDVLAHYDSETVRYFLMSGHYRSQLNYSEENLNQARAS 317
>sp|Q87YQ2|SYC_PSESM Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 460 Score = 32.7 bits (73), Expect = 1.8 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = -1 Query: 1011 NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTS 883 NFF RD L+ YH V RY L+ H RS N S + + Sbjct: 273 NFFTLRDVLEKYHPEVVRYLLVSSHYRSAINYSEDSLRESKAA 315
>sp|P13816|GARP_PLAFF Glutamic acid-rich protein precursor Length = 678 Score = 32.7 bits (73), Expect = 1.8 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 2/44 (4%) Frame = +1 Query: 52 CIVIFKLCDRDF--RSFRNGIMRSRNIMEKSFRGQYVGISNDVE 177 CI+ F +C +F + F NG+++++NI+ KSF + N+ E Sbjct: 11 CILFFVVCTLNFSTKCFSNGLLKNQNILNKSFDSITGRLLNETE 54
>sp|P21888|SYC_ECOLI Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 32.3 bits (72), Expect = 2.3 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 1038 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFN 919 ++ + ++ NFF RD LK Y RYFLM H RS N Sbjct: 264 REKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLN 303
>sp|Q83M27|SYC_SHIFL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 32.3 bits (72), Expect = 2.3 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 1038 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFN 919 ++ + ++ NFF RD LK Y RYFLM H RS N Sbjct: 264 REKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLN 303
>sp|Q9KQZ9|SYC_VIBCH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 459 Score = 32.3 bits (72), Expect = 2.3 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = -1 Query: 1038 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTS 883 ++ + ++ NFF RD L Y RYFLM H RS N + N+ S Sbjct: 264 KEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARAS 315
>sp|Q8FK44|SYC_ECOL6 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 32.3 bits (72), Expect = 2.3 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 1038 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFN 919 ++ + ++ NFF RD LK Y RYFLM H RS N Sbjct: 264 REKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLN 303
>sp|Q8XCT9|SYC_ECO57 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 32.3 bits (72), Expect = 2.3 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = -1 Query: 1038 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFN 919 ++ + ++ NFF RD LK Y RYFLM H RS N Sbjct: 264 REKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLN 303
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 102,784,431
Number of Sequences: 369166
Number of extensions: 1891394
Number of successful extensions: 4097
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 3990
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4095
length of database: 68,354,980
effective HSP length: 111
effective length of database: 47,849,395
effective search space used: 11388156010
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
