Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_028_E20 (199 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8ZR68|SYC_SALTY Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.092 sp|Q8Z8P6|SYC_SALTI Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.092 sp|Q5E4F1|SYC_VIBF1 Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.092 sp|Q5ZVY1|SYC_LEGPH Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.12 sp|Q9KQZ9|SYC_VIBCH Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.12 sp|Q5WX29|SYC_LEGPL Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.12 sp|Q5X5P9|SYC_LEGPA Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.12 sp|Q7MLR5|SYC_VIBVY Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.12 sp|Q8D8R1|SYC_VIBVU Cysteinyl-tRNA synthetase (Cysteine--tR... 34 0.12 sp|Q87QJ9|SYC_VIBPA Cysteinyl-tRNA synthetase (Cysteine--tR... 33 0.16
>sp|Q8ZR68|SYC_SALTY Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 34.3 bits (77), Expect = 0.092 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 187 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKL 20 ++ + ++ NFF RD LK Y RYFLM H RS N + + S ++L Sbjct: 264 REKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERL 319
>sp|Q8Z8P6|SYC_SALTI Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) sp|Q5PCE2|SYC_SALPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 34.3 bits (77), Expect = 0.092 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 187 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKL 20 ++ + ++ NFF RD LK Y RYFLM H RS N + + S ++L Sbjct: 264 REKMSKSLGNFFTVRDVLKYYDAETVRYFLMSGHYRSQLNYSEENLKQARASLERL 319
>sp|Q5E4F1|SYC_VIBF1 Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 461 Score = 34.3 bits (77), Expect = 0.092 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 187 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKL 20 ++ + ++ NFF RD L Y RYFLM H RS N + N+ S ++L Sbjct: 266 REKMSKSLGNFFTIRDVLAHYDSETVRYFLMSGHYRSQLNYSEENLNQARASLERL 321
>sp|Q5ZVY1|SYC_LEGPH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 456 Score = 33.9 bits (76), Expect = 0.12 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = -1 Query: 160 NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKLIQIKL 5 NF+ D LK +H V RYFL+ H RS N ++++N N K I+L Sbjct: 273 NFYTIADVLKEHHPEVIRYFLLSSHYRSPLN-----YSEENLLNAKKALIRL 319
>sp|Q9KQZ9|SYC_VIBCH Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 459 Score = 33.9 bits (76), Expect = 0.12 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 187 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKL 20 ++ + ++ NFF RD L Y RYFLM H RS N + N+ S ++L Sbjct: 264 KEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERL 319
>sp|Q5WX29|SYC_LEGPL Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 456 Score = 33.9 bits (76), Expect = 0.12 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = -1 Query: 160 NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKLIQIKL 5 NF+ D LK +H V RYFL+ H RS N ++++N N K I+L Sbjct: 273 NFYTIADVLKEHHPEVIRYFLLSSHYRSPLN-----YSEENLLNAKKALIRL 319
>sp|Q5X5P9|SYC_LEGPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 456 Score = 33.9 bits (76), Expect = 0.12 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = -1 Query: 160 NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKLIQIKL 5 NF+ D LK +H V RYFL+ H RS N ++++N N K I+L Sbjct: 273 NFYTIADVLKEHHPEVIRYFLLSSHYRSPLN-----YSEENLLNAKKALIRL 319
>sp|Q7MLR5|SYC_VIBVY Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 460 Score = 33.9 bits (76), Expect = 0.12 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 187 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKL 20 ++ + ++ NFF RD L Y RYFLM H RS N + N+ S ++L Sbjct: 264 KEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERL 319
>sp|Q8D8R1|SYC_VIBVU Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 460 Score = 33.9 bits (76), Expect = 0.12 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 187 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKL 20 ++ + ++ NFF RD L Y RYFLM H RS N + N+ S ++L Sbjct: 264 KEKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEENLNQARASLERL 319
>sp|Q87QJ9|SYC_VIBPA Cysteinyl-tRNA synthetase (Cysteine--tRNA ligase) (CysRS) Length = 460 Score = 33.5 bits (75), Expect = 0.16 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -1 Query: 187 QQHLRQTF*NFFGTRDELKPYH*IVSRYFLMKIHNRSYFNEINHSFNKKNTSNKKL 20 ++ + ++ NFF RD L Y RYFLM H RS N + N+ S ++L Sbjct: 264 REKMSKSLGNFFTIRDVLGHYDAETVRYFLMSGHYRSQLNYSEDNLNQARASLERL 319
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,817,858 Number of Sequences: 369166 Number of extensions: 245947 Number of successful extensions: 700 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 695 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 68,354,980 effective HSP length: 37 effective length of database: 61,519,785 effective search space used: 1722553980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)