DrC_00678
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00678 (1246 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9UIV1|CNOT7_HUMAN CCR4-NOT transcription complex subuni... 49 2e-05 sp|Q60809|CNOT7_MOUSE CCR4-NOT transcription complex subuni... 49 2e-05 sp|Q9UFF9|CNOT8_HUMAN CCR4-NOT transcription complex subuni... 45 4e-04 sp|Q9D8X5|CNOT8_MOUSE CCR4-NOT transcription complex subuni... 45 4e-04 sp|Q17345|CNOT7_CAEEL CCR4-NOT transcription complex subuni... 42 0.003 sp|P38177|YBI6_YEAST Hypothetical 52.0 kDa protein in RPL23... 31 8.5 sp|O00519|FAAH_HUMAN Fatty-acid amide hydrolase (Oleamide h... 31 8.5 sp|P97612|FAAH_RAT Fatty-acid amide hydrolase (Oleamide hyd... 31 8.5 sp|O08914|FAAH_MOUSE Fatty-acid amide hydrolase (Oleamide h... 31 8.5
>sp|Q9UIV1|CNOT7_HUMAN CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) (BTG1 binding factor 1) Length = 285 Score = 49.3 bits (116), Expect = 2e-05 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +3 Query: 51 GLQELSKMLKVERRGAQHQAGSDSRLTGESYFKFVLNYMECEIKPEWY-NMIFGMNFGNN 227 GLQE+++ L++ER G QHQAGSDS LTG ++FK + E I Y ++G+ G++ Sbjct: 208 GLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSS 267
>sp|Q60809|CNOT7_MOUSE CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) Length = 285 Score = 49.3 bits (116), Expect = 2e-05 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +3 Query: 51 GLQELSKMLKVERRGAQHQAGSDSRLTGESYFKFVLNYMECEIKPEWY-NMIFGMNFGNN 227 GLQE+++ L++ER G QHQAGSDS LTG ++FK + E I Y ++G+ G++ Sbjct: 208 GLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSS 267
>sp|Q9UFF9|CNOT8_HUMAN CCR4-NOT transcription complex subunit 8 (CCR4-associated factor 8) (CAF1-like protein) (CALIFp) (CAF2) Length = 292 Score = 45.1 bits (105), Expect = 4e-04 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +3 Query: 51 GLQELSKMLKVERRGAQHQAGSDSRLTGESYFKFVLNYMECEIKPEWY-NMIFGMNFG 221 GLQE++ L ++R G QHQAGSDS LTG ++F+ + E I Y ++G+ G Sbjct: 208 GLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTG 265
>sp|Q9D8X5|CNOT8_MOUSE CCR4-NOT transcription complex subunit 8 (CCR4-associated factor 8) Length = 292 Score = 45.1 bits (105), Expect = 4e-04 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +3 Query: 51 GLQELSKMLKVERRGAQHQAGSDSRLTGESYFKFVLNYMECEIKPEWY-NMIFGMNFG 221 GLQE++ L ++R G QHQAGSDS LTG ++F+ + E I Y ++G+ G Sbjct: 208 GLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTG 265
>sp|Q17345|CNOT7_CAEEL CCR4-NOT transcription complex subunit 7 (CCR4-associated factor 1) (CAF1) Length = 310 Score = 42.4 bits (98), Expect = 0.003 Identities = 26/65 (40%), Positives = 38/65 (58%), Gaps = 3/65 (4%) Frame = +3 Query: 51 GLQELSKMLKVERRGAQHQAGSDSRLTGESYFKFVLNYME---CEIKPEWYNMIFGMNFG 221 GLQE++ L V+R+G +HQAGSD+ LT ++FK + +I P +I G FG Sbjct: 223 GLQEVADQLDVKRQGVRHQAGSDALLTAATFFKIKKQFFGDNWNQIAP----LICGHMFG 278 Query: 222 NNSNL 236 S+L Sbjct: 279 LGSSL 283
>sp|P38177|YBI6_YEAST Hypothetical 52.0 kDa protein in RPL23A-BOB1 intergenic region Length = 466 Score = 30.8 bits (68), Expect = 8.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 174 EIKPEWYNMIFGMNFGNNSNLYPPVQSPDDH 266 E++ E+YN +G N GN ++ +PP S D + Sbjct: 360 EMEEEYYNPNYGNNLGNKASSWPPNPSDDGY 390
>sp|O00519|FAAH_HUMAN Fatty-acid amide hydrolase (Oleamide hydrolase) (Anandamide amidohydrolase) Length = 579 Score = 30.8 bits (68), Expect = 8.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 1085 YKTNSGTNCTTIYNQKCTTSTTKPHFPRQNIIY 987 ++ N GTNC T Y C T ++ PRQ ++Y Sbjct: 105 WEVNKGTNCVTSYLADCETQLSQA--PRQGLLY 135
>sp|P97612|FAAH_RAT Fatty-acid amide hydrolase (Oleamide hydrolase) (Anandamide amidohydrolase) Length = 579 Score = 30.8 bits (68), Expect = 8.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 1085 YKTNSGTNCTTIYNQKCTTSTTKPHFPRQNIIY 987 ++ N GTNC T Y C T ++ PRQ ++Y Sbjct: 105 WEVNKGTNCVTSYLTDCETQLSQA--PRQGLLY 135
>sp|O08914|FAAH_MOUSE Fatty-acid amide hydrolase (Oleamide hydrolase) (Anandamide amidohydrolase) Length = 579 Score = 30.8 bits (68), Expect = 8.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 1085 YKTNSGTNCTTIYNQKCTTSTTKPHFPRQNIIY 987 ++ N GTNC T Y C T ++ PRQ ++Y Sbjct: 105 WEVNKGTNCVTSYLTDCETQLSQA--PRQGLLY 135
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 140,618,516
Number of Sequences: 369166
Number of extensions: 2855276
Number of successful extensions: 6425
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 6041
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6422
length of database: 68,354,980
effective HSP length: 113
effective length of database: 47,479,925
effective search space used: 14291457425
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
