Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00647 (580 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9F495|OPGH_ERWCH Glucans biosynthesis glucosyltransfera... 33 0.51 sp|P52360|UL17_HHV7J Protein U64 32 1.5 sp|Q31673|YCX2_ASTLO Hypothetical 15.6 kDa protein in rps12... 31 2.5 sp|O84754|SYA_CHLTR Alanyl-tRNA synthetase (Alanine--tRNA l... 30 4.3
>sp|Q9F495|OPGH_ERWCH Glucans biosynthesis glucosyltransferase H Length = 850 Score = 33.1 bits (74), Expect = 0.51 Identities = 20/55 (36%), Positives = 30/55 (54%) Frame = +3 Query: 57 IMPYVTKSGEIVNSSPWSITYFKSVITGFFTMLMLFIQTLIPIDLFGYQSNTSSN 221 ++PYV +SG ++ + F V GF+T LM F+Q LI D + S T+ N Sbjct: 194 LLPYVLQSGILILFA----ILFCWVSAGFWTALMGFLQLLIGKDKYSISSTTTGN 244
>sp|P52360|UL17_HHV7J Protein U64 Length = 439 Score = 31.6 bits (70), Expect = 1.5 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 250 PENLVVSVQDQLHLVHQRVDEVNLETFLCIVASIEMFQK*LYQ--N*TFCTLFRC 408 PENL S+ + L V+ +DE+ TF CI ++E+ + L Q N F F C Sbjct: 250 PENLFSSITNYLDRVNTYLDEIAERTFRCITTNMEIQNRHLPQKFNSHFQIEFNC 304
>sp|Q31673|YCX2_ASTLO Hypothetical 15.6 kDa protein in rps12-trnP intergenic region (ORF125a) Length = 125 Score = 30.8 bits (68), Expect = 2.5 Identities = 22/42 (52%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 457 IAKYIF*KFFYEINC-IYWFIKCD*GWCLIFYKLR*NIFIYV 579 I KYIF F ++I C IYWFI IF L NIFIYV Sbjct: 81 ILKYIF-YFIFDILCYIYWFI------FSIFLSLIFNIFIYV 115
>sp|O84754|SYA_CHLTR Alanyl-tRNA synthetase (Alanine--tRNA ligase) (AlaRS) Length = 875 Score = 30.0 bits (66), Expect = 4.3 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +2 Query: 104 LVYYLFQISNYRIFHNVNAIHSNINPN-RSFWLPIK 208 LVYYL + RI H NAIH I N S W+ K Sbjct: 771 LVYYLTEEEGQRIQHYANAIHKEIPTNFISLWITEK 806
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 63,501,482
Number of Sequences: 369166
Number of extensions: 1286994
Number of successful extensions: 2712
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 2656
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2711
length of database: 68,354,980
effective HSP length: 105
effective length of database: 48,957,805
effective search space used: 4259329035
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)