DrC_00564
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00564 (280 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P30652|YOW6_CAEEL Hypothetical protein ZK643.6 precursor 37 0.014 sp|Q09662|YS51_CAEEL Hypothetical protein ZK673.1 in chromo... 32 0.45 sp|Q9XTD6|NAS12_CAEEL Zinc metalloproteinase nas-12 precurs... 30 1.7 sp|O32198|LIAS_BACSU Sensor protein liaS 29 2.9 sp|Q72SG7|TIG_LEPIC Trigger factor (TF) >gi|41018229|sp|Q8F... 29 3.9 sp|Q39685|CMB1_DIACA MADS-box protein CMB1 29 3.9 sp|Q81K82|GLGB_BACAN 1,4-alpha-glucan branching enzyme (Gly... 28 6.6 sp|Q9JI18|LRP1B_MOUSE Low-density lipoprotein receptor-rela... 28 8.6 sp|Q10025|DEGZ_CAEEL Degenerin-like protein T28D9.7 in chro... 28 8.6 sp|P15989|CO6A3_CHICK Collagen alpha 3(VI) chain precursor 28 8.6
>sp|P30652|YOW6_CAEEL Hypothetical protein ZK643.6 precursor Length = 180 Score = 37.0 bits (84), Expect = 0.014 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +1 Query: 118 CKKTCHLCGDWDDSRPDCGYAKERGDCDKID----ERICRKTCAVC 243 C KTC+ C +D+ C RG C K D ++ C K+C +C Sbjct: 134 CPKTCNACNICEDANKMCPIWVPRGFCSKFDHDKVQKSCAKSCNIC 179
>sp|Q09662|YS51_CAEEL Hypothetical protein ZK673.1 in chromosome II precursor Length = 154 Score = 32.0 bits (71), Expect = 0.45 Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 14/65 (21%) Frame = +1 Query: 100 PDVYENCKKTCHLCGDWD--------DSRPDCGYAKERGDCDKI------DERICRKTCA 237 P + + C KTC CG DS +C ++ G C ++ C KTC Sbjct: 89 PLLQQFCPKTCGFCGGGSTAAPVQCVDSSTNCANWEKNGFCSSTFYDCANKKQYCAKTCK 148 Query: 238 VCT*T 252 +CT T Sbjct: 149 LCTTT 153
>sp|Q9XTD6|NAS12_CAEEL Zinc metalloproteinase nas-12 precursor (Nematode astacin 12) Length = 384 Score = 30.0 bits (66), Expect = 1.7 Identities = 17/69 (24%), Positives = 25/69 (36%), Gaps = 25/69 (36%) Frame = +1 Query: 112 ENCKKTCHLCG--------------------DWDDSRPDCGYAKERGDC-----DKIDER 216 ++C+KTC LC +D P C G C D + + Sbjct: 316 KSCQKTCRLCSYTRMIDEDDDLTPNTTVKSVKCEDKHPRCDIYSHNGFCTLPFYDDVRYQ 375 Query: 217 ICRKTCAVC 243 +C KTC +C Sbjct: 376 LCAKTCNLC 384
>sp|O32198|LIAS_BACSU Sensor protein liaS Length = 360 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/33 (33%), Positives = 24/33 (72%) Frame = +2 Query: 143 EIGMTADQIVDMQKKEEIVIKSMREFAEKLAQF 241 EIG+ ADQ+ +M K+ E+ + S+++ + + A++ Sbjct: 106 EIGLAADQLNEMAKRVELQVASLQKLSNERAEW 138
>sp|Q72SG7|TIG_LEPIC Trigger factor (TF) sp|Q8F351|TIG_LEPIN Trigger factor (TF) Length = 451 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +2 Query: 152 MTADQIVDMQKKEEIVIKSMREFAEKLAQFALKHYF 259 MT ++ +M +K+ +K ++E +KLA+ LKHYF Sbjct: 328 MTMEKYANMVQKD---LKEVQESFQKLAETRLKHYF 360
>sp|Q39685|CMB1_DIACA MADS-box protein CMB1 Length = 233 Score = 28.9 bits (63), Expect = 3.9 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +2 Query: 161 DQIVDMQKKEEIVIKSMREFAEKLAQ 238 DQ+ D+QKKEE++ +S R KL + Sbjct: 148 DQLADLQKKEEMLFESNRALKTKLEE 173
>sp|Q81K82|GLGB_BACAN 1,4-alpha-glucan branching enzyme (Glycogen branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 645 Score = 28.1 bits (61), Expect = 6.6 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 2/66 (3%) Frame = +2 Query: 68 VLENQGKSVSVQMFMRIVRKHAIYVEIGMTADQIV--DMQKKEEIVIKSMREFAEKLAQF 241 V + +G + + + R +K ++Y E MT ++ +KKE+ + S RE AE+L + Sbjct: 121 VFDIKGYEWNDKNWSRKKKKKSVYKE-AMTVYELHFGSWKKKEDGTLYSYREMAEELIPY 179 Query: 242 ALKHYF 259 ++H F Sbjct: 180 VVEHQF 185
>sp|Q9JI18|LRP1B_MOUSE Low-density lipoprotein receptor-related protein 1B precursor (Low-density lipoprotein receptor-related protein-deleted in tumor) (LRP-DIT) Length = 4599 Score = 27.7 bits (60), Expect = 8.6 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 100 PDVYENCKKTCHLCGD-WD-DSRPDCGYAKERGDCDKIDERICRKTC 234 PD ++ CK T H W D PDC A + +CDK KTC Sbjct: 3438 PDYFQ-CKTTKHCISKLWVCDEDPDCADASDEANCDK-------KTC 3476
>sp|Q10025|DEGZ_CAEEL Degenerin-like protein T28D9.7 in chromosome II Length = 982 Score = 27.7 bits (60), Expect = 8.6 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +2 Query: 161 DQIVDMQKKEEIVIKSMREFAEKLAQFALKHYFE 262 D+I+++ + E+ R +AEK+ +KH+FE Sbjct: 553 DRIIELMNQYELNKLQRRAWAEKMQSRQMKHFFE 586
>sp|P15989|CO6A3_CHICK Collagen alpha 3(VI) chain precursor Length = 3137 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 127 TCHLCGDWDDSRPDCGYAKER 189 TCH+C D + P CGY +R Sbjct: 2589 TCHVCLDVCEPDPICGYGSQR 2609
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 28,821,323
Number of Sequences: 369166
Number of extensions: 487618
Number of successful extensions: 1457
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1404
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1455
length of database: 68,354,980
effective HSP length: 62
effective length of database: 56,901,410
effective search space used: 1707042300
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
