Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00498 (431 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O04057|ASPR_CUCPE Aspartic proteinase precursor 31 1.3 sp|Q42456|ASPR1_ORYSA Aspartic proteinase oryzasin-1 precursor 30 2.8 sp|Q80W54|FACE1_MOUSE CAAX prenyl protease 1 homolog (Preny... 29 4.8 sp|O75844|FACE1_HUMAN CAAX prenyl protease 1 homolog (Preny... 29 4.8 sp|Q10363|YDBC_SCHPO Hypothetical protein C22E12.12 in chro... 29 4.8 sp|P32528|DUR1_YEAST Urea amidolyase [Includes: Urea carbox... 29 4.8 sp|Q66198|R1AB_CVBM Replicase polyprotein 1ab (pp1ab) (ORF1... 28 8.3 sp|Q8V6W7|R1AB_CVBQ Replicase polyprotein 1ab (pp1ab) (ORF1... 28 8.3 sp|O13035|SAP_CHICK Proactivator polypeptide precursor [Con... 28 8.3
>sp|O04057|ASPR_CUCPE Aspartic proteinase precursor Length = 513 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 214 GTENQYCTSLLAQYKTQIKTLIINNRPKDEICRTINQC 327 G +Q C +++AQY I L+++ +IC IN C Sbjct: 318 GVVSQQCKAVVAQYGQTIMDLLLSEADPKKICSQINLC 355
>sp|Q42456|ASPR1_ORYSA Aspartic proteinase oryzasin-1 precursor Length = 509 Score = 29.6 bits (65), Expect = 2.8 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +1 Query: 211 TGTENQYCTSLLAQYKTQIKTLIINNRPKDEICRTINQC 327 TG +Q C ++++QY QI L++ +IC + C Sbjct: 313 TGVVSQECKTVVSQYGQQILDLLLAETQPSKICSQVGLC 351
>sp|Q80W54|FACE1_MOUSE CAAX prenyl protease 1 homolog (Prenyl protein-specific endoprotease 1) (Farnesylated proteins-converting enzyme 1) (FACE-1) (Zinc metalloproteinase Ste24 homolog) Length = 475 Score = 28.9 bits (63), Expect = 4.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 328 NIDLLFGIFHLLVGY*LLMF*FGFYIEQEGLYNIDFLFQFV 206 N L F +F +L+G L FGFY Q L + +FQF+ Sbjct: 355 NSFLCFFLFAVLIGRRELFAAFGFYDSQPTLIGLLIIFQFI 395
>sp|O75844|FACE1_HUMAN CAAX prenyl protease 1 homolog (Prenyl protein-specific endoprotease 1) (Farnesylated-proteins converting enzyme 1) (FACE-1) (Zinc metalloproteinase Ste24 homolog) Length = 475 Score = 28.9 bits (63), Expect = 4.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -2 Query: 328 NIDLLFGIFHLLVGY*LLMF*FGFYIEQEGLYNIDFLFQFV 206 N L F +F +L+G L FGFY Q L + +FQF+ Sbjct: 355 NSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFI 395
>sp|Q10363|YDBC_SCHPO Hypothetical protein C22E12.12 in chromosome I Length = 96 Score = 28.9 bits (63), Expect = 4.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 309 PNNKSMFYQSKILRNIRKLFSINQT 383 PNN++MFY+S + + + F IN+T Sbjct: 20 PNNEAMFYRSSRILHFEEAFVINET 44
>sp|P32528|DUR1_YEAST Urea amidolyase [Includes: Urea carboxylase ; Allophanate hydrolase ] Length = 1835 Score = 28.9 bits (63), Expect = 4.8 Identities = 15/62 (24%), Positives = 29/62 (46%) Frame = +1 Query: 235 TSLLAQYKTQIKTLIINNRPKDEICRTINQCFTNPKFYGIFESYFL*IKQNFQSIFFVEI 414 T++ +Y + +I++ + +D+ +NQ K YG + +K S FF + Sbjct: 1005 TNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCITNIDY-LKSIITSDFFAKA 1063 Query: 415 KV 420 KV Sbjct: 1064 KV 1065
>sp|Q66198|R1AB_CVBM Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase (3CL-PRO) (3CLp) (M-PRO) (p27); Unknown protein 1; p10; p22; p12; Growth factor-like peptide (GFL) (p15); RNA-directed RNA polymerase (RdRp) (Pol) (p100); Helicase (Hel) (p67); Unknown protein 2; p35; Unknown protein 3] Length = 7094 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 262 QIKTLIINNRPKDEICRTINQCFTNPKFYG 351 ++KT ++N+ P D+ C T QC+ N + G Sbjct: 4130 KLKTQVVNSGP-DQTCNTPTQCYYNNSYNG 4158
>sp|Q8V6W7|R1AB_CVBQ Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase (3CL-PRO) (3CLp) (M-PRO) (p27); Unknown protein 1; p10; p22; p12; Growth factor-like peptide (GFL) (p15); RNA-directed RNA polymerase (RdRp) (Pol) (p100); Helicase (Hel) (p67); Unknown protein 2; p35; Unknown protein 3] Length = 7059 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +1 Query: 262 QIKTLIINNRPKDEICRTINQCFTNPKFYG 351 ++KT ++N+ P D+ C T QC+ N + G Sbjct: 4130 KLKTQVVNSGP-DQTCNTPTQCYYNNSYNG 4158
>sp|O13035|SAP_CHICK Proactivator polypeptide precursor [Contains: Saposin A; Saposin B; Saposin C; Saposin D] Length = 518 Score = 28.1 bits (61), Expect = 8.3 Identities = 13/57 (22%), Positives = 25/57 (43%) Frame = +1 Query: 157 NPSLTTIESDLERLCKSRTGTENQYCTSLLAQYKTQIKTLIINNRPKDEICRTINQC 327 N + T IE+ LE++C + + C + QY+ + L+ +C + C Sbjct: 420 NATTTEIEALLEKVCHFLPESVSDQCVQFVEQYEPVVVQLLAEMMDPTFVCTKLGVC 476
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,592,560 Number of Sequences: 369166 Number of extensions: 762449 Number of successful extensions: 1755 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1755 length of database: 68,354,980 effective HSP length: 100 effective length of database: 49,881,480 effective search space used: 2144903640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)