Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_008_I07 (199 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q10363|YDBC_SCHPO Hypothetical protein C22E12.12 in chro... 29 3.9 sp|P69684|ILVB_PORUM Acetolactate synthase large subunit (A... 28 6.6 sp|Q66198|R1AB_CVBM Replicase polyprotein 1ab (pp1ab) (ORF1... 28 6.6 sp|Q8V6W7|R1AB_CVBQ Replicase polyprotein 1ab (pp1ab) (ORF1... 28 6.6
>sp|Q10363|YDBC_SCHPO Hypothetical protein C22E12.12 in chromosome I Length = 96 Score = 28.9 bits (63), Expect = 3.9 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 77 PNNKSMFYQSKILRNIRKLFSINQT 151 PNN++MFY+S + + + F IN+T Sbjct: 20 PNNEAMFYRSSRILHFEEAFVINET 44
>sp|P69684|ILVB_PORUM Acetolactate synthase large subunit (AHAS) (Acetohydroxy-acid synthase large subunit) (ALS) sp|P69683|ILVB_PORPU Acetolactate synthase large subunit (AHAS) (Acetohydroxy-acid synthase large subunit) (ALS) Length = 590 Score = 28.1 bits (61), Expect = 6.6 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = +3 Query: 6 GTRAQYKTQIKTLIINNR 59 GT AQYK IK +IINNR Sbjct: 466 GTIAQYKLPIKIVIINNR 483
>sp|Q66198|R1AB_CVBM Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase (3CL-PRO) (3CLp) (M-PRO) (p27); Unknown protein 1; p10; p22; p12; Growth factor-like peptide (GFL) (p15); RNA-directed RNA polymerase (RdRp) (Pol) (p100); Helicase (Hel) (p67); Unknown protein 2; p35; Unknown protein 3] Length = 7094 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 30 QIKTLIINNRPKDEICRTINQCFTNPKFYG 119 ++KT ++N+ P D+ C T QC+ N + G Sbjct: 4130 KLKTQVVNSGP-DQTCNTPTQCYYNNSYNG 4158
>sp|Q8V6W7|R1AB_CVBQ Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase (3CL-PRO) (3CLp) (M-PRO) (p27); Unknown protein 1; p10; p22; p12; Growth factor-like peptide (GFL) (p15); RNA-directed RNA polymerase (RdRp) (Pol) (p100); Helicase (Hel) (p67); Unknown protein 2; p35; Unknown protein 3] Length = 7059 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 30 QIKTLIINNRPKDEICRTINQCFTNPKFYG 119 ++KT ++N+ P D+ C T QC+ N + G Sbjct: 4130 KLKTQVVNSGP-DQTCNTPTQCYYNNSYNG 4158
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,894,604 Number of Sequences: 369166 Number of extensions: 377036 Number of successful extensions: 761 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 68,354,980 effective HSP length: 37 effective length of database: 61,519,785 effective search space used: 1722553980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)