DrC_00451
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00451 (637 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q28983|ZAN_PIG Zonadhesin precursor 33 0.80 sp|Q62599|MTA1_RAT Metastasis-associated protein MTA1 29 8.8 sp|Q8K4B0|MTA1_MOUSE Metastasis-associated protein MTA1 29 8.8 sp|P57262|NUOL_BUCAI NADH-quinone oxidoreductase chain L (N... 29 8.8 sp|Q13330|MTA1_HUMAN Metastasis-associated protein MTA1 29 8.8
>sp|Q28983|ZAN_PIG Zonadhesin precursor Length = 2476 Score = 32.7 bits (73), Expect = 0.80 Identities = 21/75 (28%), Positives = 29/75 (38%), Gaps = 10/75 (13%) Frame = +2 Query: 341 WYIDESCADKCCCQCYNKSSCG----------WRYHGFIKFSISQSW*RLCG*CWTDWKI 490 WY D SC+ C C +N SC W G I+ ++ +C T + Sbjct: 1527 WYTDNSCSRLCTCSAHNNISCRQASCKPSQMCWPQDGLIRCRVAGM--GVCRIPDTSHYV 1584 Query: 491 *FLSQYHAQGQNSSY 535 F YHA N +Y Sbjct: 1585 SFDGSYHAVRGNCTY 1599
>sp|Q62599|MTA1_RAT Metastasis-associated protein MTA1 Length = 703 Score = 29.3 bits (64), Expect = 8.8 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 362 ADKCCCQCYNKSSCGWRYHGFIKFSISQSW*RLCG*CWTDWK 487 A + C CY S W G RLC CWT WK Sbjct: 389 AGRACESCYTTQSYQWYSWGPPNMQC-----RLCASCWTYWK 425
>sp|Q8K4B0|MTA1_MOUSE Metastasis-associated protein MTA1 Length = 715 Score = 29.3 bits (64), Expect = 8.8 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 362 ADKCCCQCYNKSSCGWRYHGFIKFSISQSW*RLCG*CWTDWK 487 A + C CY S W G RLC CWT WK Sbjct: 389 AGRACESCYTTQSYQWYSWGPPNMQC-----RLCASCWTYWK 425
>sp|P57262|NUOL_BUCAI NADH-quinone oxidoreductase chain L (NADH dehydrogenase I, chain L) (NDH-1, chain L) Length = 614 Score = 29.3 bits (64), Expect = 8.8 Identities = 13/46 (28%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Frame = -1 Query: 367 VSTTFINVPTFLI----NTFTFRSVNIIASGIFIQNLRSIDFVVAF 242 VS F+ + FLI N+F F+ + ++S + ++N +D++ F Sbjct: 176 VSDVFLMIGMFLIYREFNSFNFQEIKFLSSFLNVENFYYLDYITLF 221
>sp|Q13330|MTA1_HUMAN Metastasis-associated protein MTA1 Length = 715 Score = 29.3 bits (64), Expect = 8.8 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 362 ADKCCCQCYNKSSCGWRYHGFIKFSISQSW*RLCG*CWTDWK 487 A + C CY S W G RLC CWT WK Sbjct: 389 AGRACESCYTTQSYQWYSWGPPNMQC-----RLCASCWTYWK 425
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 68,279,917
Number of Sequences: 369166
Number of extensions: 1267736
Number of successful extensions: 3074
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 2955
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3070
length of database: 68,354,980
effective HSP length: 106
effective length of database: 48,773,070
effective search space used: 5121172350
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
