DrC_00381
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00381 (455 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q46124|RPOB_CAMJE DNA-directed RNA polymerase beta chain... 31 1.1 sp|Q81WE9|PYRB_BACAN Aspartate carbamoyltransferase (Aspart... 30 2.5 sp|Q732I0|PYRB_BACC1 Aspartate carbamoyltransferase (Aspart... 30 2.5 sp|Q818W0|ARGJ_BACCR Arginine biosynthesis bifunctional pro... 30 2.5 sp|Q819S0|PYRB_BACCR Aspartate carbamoyltransferase (Aspart... 30 2.5 sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 (... 30 3.3 sp|Q6HE29|ARGJ_BACHK Arginine biosynthesis bifunctional pro... 29 4.3 sp|Q04461|YM01_YEAST Hypothetical 52.4 kDa protein in ILV2-... 29 5.6 sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog 29 5.6 sp|P91685|MGR_DROME Metabotropic glutamate receptor precursor 29 5.6
>sp|Q46124|RPOB_CAMJE DNA-directed RNA polymerase beta chain (RNAP beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1378 Score = 31.2 bits (69), Expect = 1.1 Identities = 21/70 (30%), Positives = 35/70 (50%) Frame = +3 Query: 195 INQDYAAGFKSIELNCGADVNKMPKDCYLEMITVNEAFSKEIDKLDSTCDAEYFKTLKNN 374 +N D G K+ + AD++++ K + T+ +A+SKEI K EY + Sbjct: 995 LNSDQKIGDKNYKKGQTADISELEKINRFTLTTLIKAYSKEIQK-------EYDDLKNHF 1047 Query: 375 ANARKKLLAD 404 N +KKL A+ Sbjct: 1048 QNEKKKLKAE 1057
>sp|Q81WE9|PYRB_BACAN Aspartate carbamoyltransferase (Aspartate transcarbamylase) (ATCase) sp|Q636D7|PYRB_BACCZ Aspartate carbamoyltransferase (Aspartate transcarbamylase) (ATCase) sp|Q6HES5|PYRB_BACHK Aspartate carbamoyltransferase (Aspartate transcarbamylase) (ATCase) Length = 304 Score = 30.0 bits (66), Expect = 2.5 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 234 LNCGADVNKMPKDCYLEMITVNEAFSK-EIDKLDSTCDAEYFKTLKNNANARKKL 395 LN G P C L+++T+ + F + E K+ D + + ++NA A KL Sbjct: 118 LNAGDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDVRHSRVARSNAEALTKL 172
>sp|Q732I0|PYRB_BACC1 Aspartate carbamoyltransferase (Aspartate transcarbamylase) (ATCase) Length = 304 Score = 30.0 bits (66), Expect = 2.5 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 234 LNCGADVNKMPKDCYLEMITVNEAFSK-EIDKLDSTCDAEYFKTLKNNANARKKL 395 LN G P C L+++T+ + F + E K+ D + + ++NA A KL Sbjct: 118 LNAGDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDVRHSRVARSNAEALTKL 172
>sp|Q818W0|ARGJ_BACCR Arginine biosynthesis bifunctional protein argJ [Includes: Glutamate N-acetyltransferase (Ornithine acetyltransferase) (Ornithine transacetylase) (OATase); Amino-acid acetyltransferase (N-acetylglutamate synthase) (AGS)] [Contains: Arginine biosynthesis bifunctional protein argJ alpha chain; Arginine biosynthesis bifunctional protein argJ beta chain] Length = 408 Score = 30.0 bits (66), Expect = 2.5 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +3 Query: 114 KELNKLNADYNKGGGKVDTECDDAYKKINQDYAAGFKSIELN-CGADVNKMPK 269 + +N + D+ G + C+D KKI QD K IE+N GA N+ K Sbjct: 249 RPINMEHTDWETFVGALQKVCEDLAKKIAQDGEGATKLIEVNVLGAQTNEEAK 301
>sp|Q819S0|PYRB_BACCR Aspartate carbamoyltransferase (Aspartate transcarbamylase) (ATCase) Length = 301 Score = 30.0 bits (66), Expect = 2.5 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 234 LNCGADVNKMPKDCYLEMITVNEAFSK-EIDKLDSTCDAEYFKTLKNNANARKKL 395 LN G P C L+++T+ + F + E K+ D + + ++NA A KL Sbjct: 115 LNAGDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDVRHSRVARSNAEALTKL 169
>sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 (Kinesin-like protein osm-3) Length = 699 Score = 29.6 bits (65), Expect = 3.3 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 84 QKRALNAECQKELNKLNADYNKGGGKVDT-ECDDAYKKINQ 203 +++ AE QK+L L ADY + +D ++A KKI Q Sbjct: 397 REQTSKAELQKDLESLRADYERANANLDNLNPEEAAKKIQQ 437
>sp|Q6HE29|ARGJ_BACHK Arginine biosynthesis bifunctional protein argJ [Includes: Glutamate N-acetyltransferase (Ornithine acetyltransferase) (Ornithine transacetylase) (OATase); Amino-acid acetyltransferase (N-acetylglutamate synthase) (AGS)] [Contains: Arginine biosynthesis bifunctional protein argJ alpha chain; Arginine biosynthesis bifunctional protein argJ beta chain] Length = 408 Score = 29.3 bits (64), Expect = 4.3 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +3 Query: 114 KELNKLNADYNKGGGKVDTECDDAYKKINQDYAAGFKSIELN-CGADVNKMPK 269 K +N +AD+ + C+D KKI QD K IE+N GA N+ K Sbjct: 249 KPINMEHADWETFVFALQKVCEDLAKKIAQDGEGATKLIEVNVLGAQTNEEAK 301
>sp|Q04461|YM01_YEAST Hypothetical 52.4 kDa protein in ILV2-ADE17 intergenic region Length = 462 Score = 28.9 bits (63), Expect = 5.6 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = +3 Query: 273 CYLEMITVNEAFSKEIDKLDSTCDAEYFKTLKNNANARKKLLADCAAAR 419 C L M + E FSK++DKL+ +Y TLK R+ L + AR Sbjct: 396 CRLSMSQLYEYFSKKMDKLE-----DYSLTLKRRGKPRRIFLLEEREAR 439
>sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog Length = 1339 Score = 28.9 bits (63), Expect = 5.6 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +3 Query: 201 QDYAAGFKSIELNCG-ADVNKMPKDCYLEMITVNEAFSKEIDKLDSTCDAEYFKTLKNNA 377 +D A FK +E C AD N P C + V E+FSKE D D Y + Sbjct: 475 EDRALLFKLVEDACSVADENSAPILCSKFLFPVIESFSKESD--DCVVSPVYNMLFFLSV 532 Query: 378 NARKKLLADC 407 N + L DC Sbjct: 533 NFQNPGLKDC 542
>sp|P91685|MGR_DROME Metabotropic glutamate receptor precursor Length = 976 Score = 28.9 bits (63), Expect = 5.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 123 NKLNADYNKGGGKVDTECDDAYK 191 N N+ NK G K TECDD+Y+ Sbjct: 383 NSANSTDNKIGVKAKTECDDSYR 405
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 43,454,102
Number of Sequences: 369166
Number of extensions: 710841
Number of successful extensions: 1773
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1745
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1772
length of database: 68,354,980
effective HSP length: 101
effective length of database: 49,696,745
effective search space used: 2484837250
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
