DrC_00186
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00186 (526 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P68037|UB2L3_MOUSE Ubiquitin-conjugating enzyme E2 L3 (U... 132 4e-31 sp|P52487|UBC84_DROME Ubiquitin-conjugating enzyme E2-18 kD... 123 3e-28 sp|O14933|UB2L6_HUMAN Ubiquitin-conjugating enzyme E2 L6 (U... 102 4e-22 sp|Q9QZU9|UB2L6_MOUSE Ubiquitin-conjugating enzyme E2 L6 (U... 96 5e-20 sp|P63146|UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B (Ub... 79 5e-15 sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 (Ubi... 76 4e-14 sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A (Ub... 76 6e-14 sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kD... 74 2e-13 sp|Q9CQ37|UBE2T_MOUSE Ubiquitin-conjugating enzyme E2 T (Ub... 74 2e-13 sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2-17 kDa... 73 5e-13
>sp|P68037|UB2L3_MOUSE Ubiquitin-conjugating enzyme E2 L3 (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcM4) sp|P68036|UB2L3_HUMAN Ubiquitin-conjugating enzyme E2 L3 (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcH7) (E2-F1) (L-UBC) Length = 154 Score = 132 bits (333), Expect = 4e-31 Identities = 54/121 (44%), Positives = 82/121 (67%) Frame = +2 Query: 50 FKITKADPSNIFEWEGLLYPSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPIYHPNVDE 229 F+ + D +N+ W+GL+ P NPP+++ AF + + F +PFKPP IT KT IYHPN+DE Sbjct: 22 FRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDE 81 Query: 230 QGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAK 409 +G VCL +I+A NWKP + +Q+I+ L++ P P H LR D+ EE++K +F K A+ Sbjct: 82 KGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAE 141 Query: 410 D 412 + Sbjct: 142 E 142
>sp|P52487|UBC84_DROME Ubiquitin-conjugating enzyme E2-18 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 153 Score = 123 bits (308), Expect = 3e-28 Identities = 53/128 (41%), Positives = 82/128 (64%) Frame = +2 Query: 29 KAQITVFFKITKADPSNIFEWEGLLYPSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPI 208 +A+++ I +D S + W GLL P P+N+ AF + + F +PF PP I KT I Sbjct: 16 EAKMSTLRNIESSDES-LLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMPPKILFKTKI 74 Query: 209 YHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNS 388 YHPNVDE+G+VCL +I+ +NWKP + EQ+++ ++ P+P H LR D+ EEF + + Sbjct: 75 YHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHK 134 Query: 389 EFMKKAKD 412 +FMK A++ Sbjct: 135 KFMKTAEE 142
>sp|O14933|UB2L6_HUMAN Ubiquitin-conjugating enzyme E2 L6 (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcH8) (Retinoic acid-induced gene B protein) (RIG-B) Length = 152 Score = 102 bits (255), Expect = 4e-22 Identities = 44/122 (36%), Positives = 72/122 (59%) Frame = +2 Query: 47 FFKITKADPSNIFEWEGLLYPSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPIYHPNVD 226 + + +D +N+ W LL P PP++ AF++ + F +PFKPP I T IYHPNVD Sbjct: 20 YLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVD 79 Query: 227 EQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKA 406 E G +CL +I++ NWKP + Q+++ L+++P+ LR D+ + T+ F K A Sbjct: 80 ENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA 139 Query: 407 KD 412 ++ Sbjct: 140 EE 141
>sp|Q9QZU9|UB2L6_MOUSE Ubiquitin-conjugating enzyme E2 L6 (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcM8) Length = 152 Score = 95.9 bits (237), Expect = 5e-20 Identities = 48/137 (35%), Positives = 76/137 (55%) Frame = +2 Query: 2 SKELAAVKDKAQITVFFKITKADPSNIFEWEGLLYPSNPPFNEFAFDVLLKFSDNHPFKP 181 +KEL ++ ++ + + +D +N+ W LL P P+ AF V + F +PFKP Sbjct: 7 AKELESLSK--ELPPYLRQLSSDDANVLVWHMLLLPDQLPYGLKAFQVRIDFpreYPFKP 64 Query: 182 PTITMKTPIYHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDV 361 PT+ T IYHPNV E G VCL LI+ NWKP + Q+++ L+ KP+ +R ++ Sbjct: 65 PTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLEL 124 Query: 362 GEEFTKRNSEFMKKAKD 412 + T+ F KKA++ Sbjct: 125 ADLLTQNPEMFRKKAEE 141
>sp|P63146|UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) sp|P63148|UBE2B_RABIT Ubiquitin-conjugating enzyme E2 B (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) sp|P63147|UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) sp|P63149|UBE2B_RAT Ubiquitin-conjugating enzyme E2 B (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 79.3 bits (194), Expect = 5e-15 Identities = 32/111 (28%), Positives = 60/111 (54%), Gaps = 1/111 (0%) Frame = +2 Query: 74 SNIFEWEGLLY-PSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPIYHPNVDEQGDVCLA 250 +NI +W +++ P PF + F ++++FS+ +P KPPT+ + ++HPNV G +CL Sbjct: 31 NNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLD 90 Query: 251 LINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKK 403 ++ N W P I+ L+D+P+PN + + + E+ K+ Sbjct: 91 ILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR 140
>sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 76.3 bits (186), Expect = 4e-14 Identities = 33/112 (29%), Positives = 59/112 (52%), Gaps = 1/112 (0%) Frame = +2 Query: 77 NIFEWEGLLY-PSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPIYHPNVDEQGDVCLAL 253 NI WE +++ P PF + F + L+F++ +P KPPT+ + ++HPNV G +CL + Sbjct: 32 NILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDI 91 Query: 254 INANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAK 409 + N W P I+ L+D+P+PN + + + E+ K+ + Sbjct: 92 LQ-NRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQ 142
>sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) sp|P49459|UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 75.9 bits (185), Expect = 6e-14 Identities = 31/111 (27%), Positives = 58/111 (52%), Gaps = 1/111 (0%) Frame = +2 Query: 74 SNIFEWEGLLY-PSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPIYHPNVDEQGDVCLA 250 +NI W +++ P PF + F + ++F++ +P KPPT+ + ++HPNV G +CL Sbjct: 31 NNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLD 90 Query: 251 LINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKK 403 ++ N W P I+ L+D+P+PN + + + E+ K+ Sbjct: 91 ILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR 140
>sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 73.9 bits (180), Expect = 2e-13 Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 1/113 (0%) Frame = +2 Query: 74 SNIFEWEGLLY-PSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPIYHPNVDEQGDVCLA 250 +NI W +++ P + PF + F + ++F++ +P KPPT+ + ++HPNV G +CL Sbjct: 31 NNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLD 90 Query: 251 LINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAK 409 ++ N W P I+ L+ P+PN + + + E+ K+ K Sbjct: 91 ILQ-NRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVK 142
>sp|Q9CQ37|UBE2T_MOUSE Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 204 Score = 73.9 bits (180), Expect = 2e-13 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 3/107 (2%) Frame = +2 Query: 98 LLYPSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPIYHPNVDEQGDVCLALIN---ANN 268 +L +N P+ + F + + + +PF+PP + TPIYHPN+D G +CL ++ Sbjct: 38 ILGGANTPYEKGVFTLEVIIPERYPFEPPQVRFLTPIYHPNIDSSGRICLDILKLPPKGA 97 Query: 269 WKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAK 409 W+P + ++ L+ +P+P+ L D+ EF F+KKAK Sbjct: 98 WRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYNKIAFLKKAK 144
>sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 1 (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 72.8 bits (177), Expect = 5e-13 Identities = 30/114 (26%), Positives = 62/114 (54%), Gaps = 1/114 (0%) Frame = +2 Query: 74 SNIFEWEGLLY-PSNPPFNEFAFDVLLKFSDNHPFKPPTITMKTPIYHPNVDEQGDVCLA 250 +NI W +++ P + P++ F + L+FS+++P KPPT+ + ++HPN+ G +CL Sbjct: 31 NNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLD 90 Query: 251 LINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAKD 412 ++ N W P+ I+ L+ P+PN + +++ E+ ++ +D Sbjct: 91 ILQ-NQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRD 143
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 55,737,606
Number of Sequences: 369166
Number of extensions: 1087953
Number of successful extensions: 3050
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 2942
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2996
length of database: 68,354,980
effective HSP length: 103
effective length of database: 49,327,275
effective search space used: 3502236525
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
