Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_028_H05 (515 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P68037|UB2L3_MOUSE Ubiquitin-conjugating enzyme E2 L3 (U... 133 3e-31 sp|P52487|UBC84_DROME Ubiquitin-conjugating enzyme E2-18 kD... 123 3e-28 sp|O14933|UB2L6_HUMAN Ubiquitin-conjugating enzyme E2 L6 (U... 102 4e-22 sp|Q9QZU9|UB2L6_MOUSE Ubiquitin-conjugating enzyme E2 L6 (U... 97 2e-20 sp|P63146|UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B (Ub... 80 2e-15 sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 (Ubi... 77 2e-14 sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A (Ub... 77 2e-14 sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kD... 75 9e-14 sp|Q9CQ37|UBE2T_MOUSE Ubiquitin-conjugating enzyme E2 T (Ub... 75 9e-14 sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2-17 kDa... 74 2e-13
>sp|P68037|UB2L3_MOUSE Ubiquitin-conjugating enzyme E2 L3 (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcM4) sp|P68036|UB2L3_HUMAN Ubiquitin-conjugating enzyme E2 L3 (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcH7) (E2-F1) (L-UBC) Length = 154 Score = 133 bits (334), Expect = 3e-31 Identities = 54/121 (44%), Positives = 82/121 (67%) Frame = +2 Query: 41 FKITKADPSNIFEWEGLLYPSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYHPNVDE 220 F+ + D +N+ W+GL+ P NPP+++ AF + + F +PFKPP IT KT IYHPN+DE Sbjct: 22 FRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDE 81 Query: 221 QGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAK 400 +G VCL +I+A NWKP + +Q+I+ L++ P P H LR D+ EE++K +F K A+ Sbjct: 82 KGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAE 141 Query: 401 D 403 + Sbjct: 142 E 142
>sp|P52487|UBC84_DROME Ubiquitin-conjugating enzyme E2-18 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 153 Score = 123 bits (308), Expect = 3e-28 Identities = 53/128 (41%), Positives = 82/128 (64%) Frame = +2 Query: 20 KAEITVFFKITKADPSNIFEWEGLLYPSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPI 199 +A+++ I +D S + W GLL P P+N+ AF + + F +PF PP I KT I Sbjct: 16 EAKMSTLRNIESSDES-LLMWTGLLVPEKAPYNKGAFRIEINFPPQYPFMPPKILFKTKI 74 Query: 200 YHPNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNS 379 YHPNVDE+G+VCL +I+ +NWKP + EQ+++ ++ P+P H LR D+ EEF + + Sbjct: 75 YHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPEHPLRSDLAEEFVREHK 134 Query: 380 EFMKKAKD 403 +FMK A++ Sbjct: 135 KFMKTAEE 142
>sp|O14933|UB2L6_HUMAN Ubiquitin-conjugating enzyme E2 L6 (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcH8) (Retinoic acid-induced gene B protein) (RIG-B) Length = 152 Score = 102 bits (255), Expect = 4e-22 Identities = 44/122 (36%), Positives = 72/122 (59%) Frame = +2 Query: 38 FFKITKADPSNIFEWEGLLYPSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYHPNVD 217 + + +D +N+ W LL P PP++ AF++ + F +PFKPP I T IYHPNVD Sbjct: 20 YLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVD 79 Query: 218 EQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKA 397 E G +CL +I++ NWKP + Q+++ L+++P+ LR D+ + T+ F K A Sbjct: 80 ENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA 139 Query: 398 KD 403 ++ Sbjct: 140 EE 141
>sp|Q9QZU9|UB2L6_MOUSE Ubiquitin-conjugating enzyme E2 L6 (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcM8) Length = 152 Score = 97.1 bits (240), Expect = 2e-20 Identities = 46/126 (36%), Positives = 70/126 (55%) Frame = +2 Query: 26 EITVFFKITKADPSNIFEWEGLLYPSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYH 205 E+ + + +D +N+ W LL P P+ AF V + F +PFKPPT+ T IYH Sbjct: 16 ELPPYLRQLSSDDANVLVWHMLLLPDQLPYGLKAFQVRIDFpreYPFKPPTLRFTTKIYH 75 Query: 206 PNVDEQGDVCLALINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEF 385 PNV E G VCL LI+ NWKP + Q+++ L+ KP+ +R ++ + T+ F Sbjct: 76 PNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLTQNPEMF 135 Query: 386 MKKAKD 403 KKA++ Sbjct: 136 RKKAEE 141
>sp|P63146|UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) sp|P63148|UBE2B_RABIT Ubiquitin-conjugating enzyme E2 B (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) sp|P63147|UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) sp|P63149|UBE2B_RAT Ubiquitin-conjugating enzyme E2 B (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 80.5 bits (197), Expect = 2e-15 Identities = 33/111 (29%), Positives = 60/111 (54%), Gaps = 1/111 (0%) Frame = +2 Query: 65 SNIFEWEGLLY-PSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLA 241 +NI +W +++ P PF + F ++++FSE +P KPPT+ + ++HPNV G +CL Sbjct: 31 NNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLD 90 Query: 242 LINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKK 394 ++ N W P I+ L+D+P+PN + + + E+ K+ Sbjct: 91 ILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR 140
>sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 77.4 bits (189), Expect = 2e-14 Identities = 34/112 (30%), Positives = 59/112 (52%), Gaps = 1/112 (0%) Frame = +2 Query: 68 NIFEWEGLLY-PSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLAL 244 NI WE +++ P PF + F + L+F+E +P KPPT+ + ++HPNV G +CL + Sbjct: 32 NILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDI 91 Query: 245 INANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAK 400 + N W P I+ L+D+P+PN + + + E+ K+ + Sbjct: 92 LQ-NRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQ 142
>sp|Q9Z255|UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) sp|P49459|UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 77.0 bits (188), Expect = 2e-14 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 1/111 (0%) Frame = +2 Query: 65 SNIFEWEGLLY-PSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLA 241 +NI W +++ P PF + F + ++F+E +P KPPT+ + ++HPNV G +CL Sbjct: 31 NNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLD 90 Query: 242 LINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKK 394 ++ N W P I+ L+D+P+PN + + + E+ K+ Sbjct: 91 ILQ-NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKR 140
>sp|P25153|UBCD6_DROME Ubiquitin-conjugating enzyme E2-17 kDa (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 75.1 bits (183), Expect = 9e-14 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 1/113 (0%) Frame = +2 Query: 65 SNIFEWEGLLY-PSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLA 241 +NI W +++ P + PF + F + ++F+E +P KPPT+ + ++HPNV G +CL Sbjct: 31 NNIMIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNVYADGGICLD 90 Query: 242 LINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAK 400 ++ N W P I+ L+ P+PN + + + E+ K+ K Sbjct: 91 ILQ-NRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVK 142
>sp|Q9CQ37|UBE2T_MOUSE Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 204 Score = 75.1 bits (183), Expect = 9e-14 Identities = 34/107 (31%), Positives = 57/107 (53%), Gaps = 3/107 (2%) Frame = +2 Query: 89 LLYPSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLALIN---ANN 259 +L +N P+ + F + + E +PF+PP + TPIYHPN+D G +CL ++ Sbjct: 38 ILGGANTPYEKGVFTLEVIIPERYPFEPPQVRFLTPIYHPNIDSSGRICLDILKLPPKGA 97 Query: 260 WKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAK 400 W+P + ++ L+ +P+P+ L D+ EF F+KKAK Sbjct: 98 WRPSLNIATVLTSIQLLMAEPNPDDPLMADISSEFKYNKIAFLKKAK 144
>sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 1 (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 73.9 bits (180), Expect = 2e-13 Identities = 31/114 (27%), Positives = 62/114 (54%), Gaps = 1/114 (0%) Frame = +2 Query: 65 SNIFEWEGLLY-PSNPPFNEFAFDVLLKFSENHPFKPPTITMKTPIYHPNVDEQGDVCLA 241 +NI W +++ P + P++ F + L+FSE++P KPPT+ + ++HPN+ G +CL Sbjct: 31 NNIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLD 90 Query: 242 LINANNWKPVVQAEQIIKEFAQLIDKPDPNHFLRGDVGEEFTKRNSEFMKKAKD 403 ++ N W P+ I+ L+ P+PN + +++ E+ ++ +D Sbjct: 91 ILQ-NQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARMYSESKREYNRRVRD 143
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,344,690 Number of Sequences: 369166 Number of extensions: 1056917 Number of successful extensions: 3074 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2963 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3020 length of database: 68,354,980 effective HSP length: 103 effective length of database: 49,327,275 effective search space used: 3354254700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)