Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00119 (952 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P41997|YKC6_CAEEL Hypothetical protein B0280.6 in chromo... 49 3e-05 sp|O35923|BRCA2_RAT Breast cancer type 2 susceptibility pro... 32 3.4 sp|Q01634|IDUA_CANFA Alpha-L-iduronidase precursor 30 7.7 sp|P09201|F16P_YEAST Fructose-1,6-bisphosphatase (D-fructos... 30 7.7 sp|O88382|AIP1_RAT Atrophin-1-interacting protein 1 (Membra... 30 7.7 sp|Q9WVQ1|AIP1_MOUSE Atrophin-1-interacting protein 1 (Memb... 30 7.7 sp|Q86UL8|AIP1_HUMAN Atrophin-1-interacting protein 1 (Atro... 30 7.7
>sp|P41997|YKC6_CAEEL Hypothetical protein B0280.6 in chromosome III Length = 252 Score = 48.5 bits (114), Expect = 3e-05 Identities = 23/62 (37%), Positives = 34/62 (54%) Frame = +3 Query: 609 LLHDNARPHTPKTTVDNLTSLDLAVPPYVAYSPNMVPSDYYLLKSVQYYFDDSQFKNIED 788 L+ + +PH K T L L V P+ YSP++ P+DY+L S+ Y D QF + E Sbjct: 152 LVTGDEKPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEH 211 Query: 789 VK 794 +K Sbjct: 212 LK 213
>sp|O35923|BRCA2_RAT Breast cancer type 2 susceptibility protein homolog (Fanconi anemia group D1 protein homolog) Length = 3343 Score = 31.6 bits (70), Expect = 3.4 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 10 PYNYVTILYLSPSHLHLMVYQFQINLGRSILPRI 111 P ++YLS LHL+V +F I+L I PR+ Sbjct: 3012 PIGLAPLVYLSDECLHLLVVKFGIDLNEDIKPRV 3045
>sp|Q01634|IDUA_CANFA Alpha-L-iduronidase precursor Length = 655 Score = 30.4 bits (67), Expect = 7.7 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 11/76 (14%) Frame = +3 Query: 483 HYEFMKHGETI--TSETYRNQLSCLQEVLEKNRPFYGTGT-------RL--VILLHDNAR 629 H E+ + G + T+E +R + V E RPF +G RL ++LLH AR Sbjct: 483 HGEWQRLGRPVFPTAEEFRRMRAAEDPVAEAPRPFPASGRLTLSVELRLPSLLLLHVCAR 542 Query: 630 PHTPKTTVDNLTSLDL 677 P P V L +L L Sbjct: 543 PEKPPGPVTRLRALPL 558
>sp|P09201|F16P_YEAST Fructose-1,6-bisphosphatase (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) Length = 348 Score = 30.4 bits (67), Expect = 7.7 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +3 Query: 516 TSETYRNQLSCLQEVLEKNRPFYGTGTRLVILLHDNARPHTPKTTVDN--LTSLDLAVPP 689 +S T + L C +E++ YG+ T LV+ L D T T + LT +L +PP Sbjct: 155 SSGTINDVLRCGKEMVAACYAMYGSSTHLVLTLGDGVDGFTLDTNLGEFILTHPNLRIPP 214 Query: 690 YVA-YSPN 710 A YS N Sbjct: 215 QKAIYSIN 222
>sp|O88382|AIP1_RAT Atrophin-1-interacting protein 1 (Membrane-associated guanylate kinase inverted-2) (MAGI-2) (Synaptic scaffolding molecule) (S-SCAM) Length = 1277 Score = 30.4 bits (67), Expect = 7.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 295 PDFRKRIFCTRSLQGMRNGYIMTTLNKKNLGF 390 P FR++ TR ++ ++ TTL K N+GF Sbjct: 405 PGFREKPLFTRDASQLKGTFLSTTLKKSNMGF 436
>sp|Q9WVQ1|AIP1_MOUSE Atrophin-1-interacting protein 1 (Membrane-associated guanylate kinase inverted-2) (MAGI-2) (Activin receptor-interacting protein 1) (Acvrip1) Length = 1275 Score = 30.4 bits (67), Expect = 7.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 295 PDFRKRIFCTRSLQGMRNGYIMTTLNKKNLGF 390 P FR++ TR ++ ++ TTL K N+GF Sbjct: 404 PGFREKPLFTRDASQLKGTFLSTTLKKSNMGF 435
>sp|Q86UL8|AIP1_HUMAN Atrophin-1-interacting protein 1 (Atrophin-1-interacting protein A) (Membrane-associated guanylate kinase inverted-2) (MAGI-2) Length = 1455 Score = 30.4 bits (67), Expect = 7.7 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 295 PDFRKRIFCTRSLQGMRNGYIMTTLNKKNLGF 390 P FR++ TR ++ ++ TTL K N+GF Sbjct: 405 PGFREKPLFTRDASQLKGTFLSTTLKKSNMGF 436
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 109,462,000
Number of Sequences: 369166
Number of extensions: 2263801
Number of successful extensions: 5078
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 4926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5076
length of database: 68,354,980
effective HSP length: 110
effective length of database: 48,034,130
effective search space used: 9895030780
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)