Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_020_H01 (705 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P41997|YKC6_CAEEL Hypothetical protein B0280.6 in chromo... 49 2e-05 sp|Q01634|IDUA_CANFA Alpha-L-iduronidase precursor 30 4.8 sp|P09201|F16P_YEAST Fructose-1,6-bisphosphatase (D-fructos... 30 4.8 sp|O88382|AIP1_RAT Atrophin-1-interacting protein 1 (Membra... 30 4.8 sp|Q9WVQ1|AIP1_MOUSE Atrophin-1-interacting protein 1 (Memb... 30 4.8 sp|Q86UL8|AIP1_HUMAN Atrophin-1-interacting protein 1 (Atro... 30 4.8 sp|Q58907|RGYR_METJA Reverse gyrase [Includes: Helicase ; T... 30 6.2 sp|P38298|YPC1_YEAST Alkaline ceramidase YPC1 30 8.2 sp|Q5H8C1|FREM1_HUMAN FRAS1-related extracellular matrix pr... 30 8.2 sp|Q9RNZ1|ISPDF_ZYMMO IspD/ispF bifunctional enzyme [Includ... 30 8.2
>sp|P41997|YKC6_CAEEL Hypothetical protein B0280.6 in chromosome III Length = 252 Score = 48.5 bits (114), Expect = 2e-05 Identities = 23/62 (37%), Positives = 34/62 (54%) Frame = +2 Query: 362 LLHDNARPHTPKTTVDNLTSLDLAVPPYVAYSPNMVPSDYYLLKSVQYYFDDSQFKNIED 541 L+ + +PH K T L L V P+ YSP++ P+DY+L S+ Y D QF + E Sbjct: 152 LVTGDEKPHVAKKTFQKLQDLGWTVLPHPPYSPDLAPTDYHLFLSLSDYMRDKQFDDEEH 211 Query: 542 VK 547 +K Sbjct: 212 LK 213
>sp|Q01634|IDUA_CANFA Alpha-L-iduronidase precursor Length = 655 Score = 30.4 bits (67), Expect = 4.8 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 11/76 (14%) Frame = +2 Query: 236 HYEFMKHGETI--TSETYRNQLSCLQEVLEKNRPFYGTGT-------RL--VILLHDNAR 382 H E+ + G + T+E +R + V E RPF +G RL ++LLH AR Sbjct: 483 HGEWQRLGRPVFPTAEEFRRMRAAEDPVAEAPRPFPASGRLTLSVELRLPSLLLLHVCAR 542 Query: 383 PHTPKTTVDNLTSLDL 430 P P V L +L L Sbjct: 543 PEKPPGPVTRLRALPL 558
>sp|P09201|F16P_YEAST Fructose-1,6-bisphosphatase (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) Length = 348 Score = 30.4 bits (67), Expect = 4.8 Identities = 23/68 (33%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +2 Query: 269 TSETYRNQLSCLQEVLEKNRPFYGTGTRLVILLHDNARPHTPKTTVDN--LTSLDLAVPP 442 +S T + L C +E++ YG+ T LV+ L D T T + LT +L +PP Sbjct: 155 SSGTINDVLRCGKEMVAACYAMYGSSTHLVLTLGDGVDGFTLDTNLGEFILTHPNLRIPP 214 Query: 443 YVA-YSPN 463 A YS N Sbjct: 215 QKAIYSIN 222
>sp|O88382|AIP1_RAT Atrophin-1-interacting protein 1 (Membrane-associated guanylate kinase inverted-2) (MAGI-2) (Synaptic scaffolding molecule) (S-SCAM) Length = 1277 Score = 30.4 bits (67), Expect = 4.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 48 PDFRKRIFCTRSLQGMRNGYIMTTLNKKNLGF 143 P FR++ TR ++ ++ TTL K N+GF Sbjct: 405 PGFREKPLFTRDASQLKGTFLSTTLKKSNMGF 436
>sp|Q9WVQ1|AIP1_MOUSE Atrophin-1-interacting protein 1 (Membrane-associated guanylate kinase inverted-2) (MAGI-2) (Activin receptor-interacting protein 1) (Acvrip1) Length = 1275 Score = 30.4 bits (67), Expect = 4.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 48 PDFRKRIFCTRSLQGMRNGYIMTTLNKKNLGF 143 P FR++ TR ++ ++ TTL K N+GF Sbjct: 404 PGFREKPLFTRDASQLKGTFLSTTLKKSNMGF 435
>sp|Q86UL8|AIP1_HUMAN Atrophin-1-interacting protein 1 (Atrophin-1-interacting protein A) (Membrane-associated guanylate kinase inverted-2) (MAGI-2) Length = 1455 Score = 30.4 bits (67), Expect = 4.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 48 PDFRKRIFCTRSLQGMRNGYIMTTLNKKNLGF 143 P FR++ TR ++ ++ TTL K N+GF Sbjct: 405 PGFREKPLFTRDASQLKGTFLSTTLKKSNMGF 436
>sp|Q58907|RGYR_METJA Reverse gyrase [Includes: Helicase ; Topoisomerase ] [Contains: Mja r-Gyr intein] Length = 1613 Score = 30.0 bits (66), Expect = 6.2 Identities = 35/116 (30%), Positives = 50/116 (43%), Gaps = 2/116 (1%) Frame = +2 Query: 62 KDFLHKIVTGDEKWIYYDNPKQKESWVYAGQPYSLIVKRNIH*AK--VLLCIC*DYLRVV 235 K+FL KIV GD I + K+ E+ Y G Y L +K N + V+ C Y R Sbjct: 1312 KEFLEKIVNGD---ISFVRVKKVENIPYDGYVYDLSIKHNQNFISNGVISHNC-TYHRTS 1367 Query: 236 HYEFMKHGETITSETYRNQLSCLQEVLEKNRPFYGTGTRLVILLHDNARPHTPKTT 403 G + E + L+ L++ L KNR ++ G H+ RP P T Sbjct: 1368 STRVSLDGMRVAREYLK--LNNLEDYL-KNREYFMEGA------HECIRPTKPMNT 1414
>sp|P38298|YPC1_YEAST Alkaline ceramidase YPC1 Length = 316 Score = 29.6 bits (65), Expect = 8.2 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 2/57 (3%) Frame = -2 Query: 443 MGELPSLKRLDCPLWSLACEVERC--HGEELRA*FQYHKMVYFFQELLEGNSIGFGM 279 + ELP + + P WSL CE + +G+ HK V F+++ G IG + Sbjct: 97 LDELPMIYAMCIPTWSLVCEAKEALLNGDN-------HKKVPLFEQIFIGVIIGLAV 146
>sp|Q5H8C1|FREM1_HUMAN FRAS1-related extracellular matrix protein 1 precursor (QBRICK protein) Length = 2179 Score = 29.6 bits (65), Expect = 8.2 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +2 Query: 392 PKTTVDNLTSLDLAVPPYVAYSPNMVPSDYYLLKSVQYYFDDSQFKNIEDVKN*F*ITMN 571 P T D+L + L PP Y N++PS + ++ D Q+K++ N F I Sbjct: 1053 PDTAADDLEFV-LVSPPQFGYLENILPSVGFEKSNIGISIDSFQWKDM----NAFHINYV 1107 Query: 572 QNRHL 586 Q+RHL Sbjct: 1108 QSRHL 1112
>sp|Q9RNZ1|ISPDF_ZYMMO IspD/ispF bifunctional enzyme [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT); 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECPS) (MECDP-synthase)] Length = 386 Score = 29.6 bits (65), Expect = 8.2 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 359 ILLHDNARPHTPKTTVDNL 415 +L+HD ARP PKT +D L Sbjct: 103 VLIHDAARPFLPKTVIDRL 121
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,664,270 Number of Sequences: 369166 Number of extensions: 1705724 Number of successful extensions: 3840 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3839 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 6170718545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)