DrC_00091
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00091 (665 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P16750|UL74_HCMVA Glycoprotein UL74 precursor 33 0.51 sp|Q7A004|SARU_STAAW HTH-type transcriptional regulator sar... 32 2.0 sp|P58145|ROAA_ASTLO Ribosomal operon-associated A protein ... 32 2.0 sp|Q9EZK4|SARU_STAAU HTH-type transcriptional regulator sar... 32 2.0 sp|Q9S597|C27AA_BACUH Pesticidal crystal protein cry27Aa (I... 31 2.5 sp|P48303|EDG1_RAT Sphingosine 1-phosphate receptor Edg-1 (... 30 5.7 sp|Q8ZIG8|LEU1_YERPE 2-isopropylmalate synthase (Alpha-isop... 30 5.7 sp|O08530|EDG1_MOUSE Sphingosine 1-phosphate receptor Edg-1... 30 5.7 sp|Q58791|YD96_METJA Hypothetical protein MJ1396 29 9.7
>sp|P16750|UL74_HCMVA Glycoprotein UL74 precursor Length = 466 Score = 33.5 bits (75), Expect = 0.51 Identities = 28/88 (31%), Positives = 42/88 (47%), Gaps = 11/88 (12%) Frame = +1 Query: 55 DHSKTYLP-KLSSEKLSKDIKPELSWYDYTNK----KNYKCSTLPNT------INVYRRP 201 ++S TYL S +L K K S Y++T K + C T+P+ +NV +R Sbjct: 103 NYSITYLWFDFYSTQLRKPAKYVYSQYNHTAKTITFRPPPCGTVPSMTCLSEMLNVSKRN 162 Query: 202 LTTSQDIGFFHEYNPLLKNLPWMHVKRY 285 T Q G F +NP+ N+P + K Y Sbjct: 163 DTGEQGCGNFTTFNPMFFNVPRWNTKLY 190
>sp|Q7A004|SARU_STAAW HTH-type transcriptional regulator sarU (Staphylococcal accessory regulator U) sp|Q6G6H6|SARU_STAAS HTH-type transcriptional regulator sarU (Staphylococcal accessory regulator U) sp|Q7A3K0|SARU_STAAN HTH-type transcriptional regulator sarU (Staphylococcal accessory regulator U) sp|Q99RD5|SARU_STAAM HTH-type transcriptional regulator sarU (Staphylococcal accessory regulator U) Length = 247 Score = 31.6 bits (70), Expect = 2.0 Identities = 35/137 (25%), Positives = 58/137 (42%), Gaps = 17/137 (12%) Frame = +3 Query: 276 KKISCRSRRNDKICQ--------------PNSSNKSYILFVLIVYLSFISKFITKLIFRI 413 KKI+C DKI + P S + +ILF+ I+Y K+ L F Sbjct: 102 KKIACVINELDKIIKGFNKERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLD 161 Query: 414 ISASMNYCMTRNNNFNVC*LFTFVFEMNSSV*YPKMYLKTLTYINTAEFLLNNSHL---K 584 +S +N N+ LF + M YP++ ++++ +N L+ L + Sbjct: 162 LSILYVISSRKNEILNLKDLFESIRFM-----YPQI-VRSVNRLNNKGMLIKERSLADER 215 Query: 585 LKLYKLNVIGYYTKLSV 635 + L K+N I Y T S+ Sbjct: 216 IVLIKINKIQYNTIKSI 232
>sp|P58145|ROAA_ASTLO Ribosomal operon-associated A protein (RoaA) Length = 519 Score = 31.6 bits (70), Expect = 2.0 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 13/90 (14%) Frame = +2 Query: 311 DLSTKFF*QILHSFCFDCLPKFYQQIHY*I---NFSYYFCFYELLYD*K*QFQRLLI--- 472 +LS KF + + FCF+ L KF + NF + F FY LYD F+++L+ Sbjct: 110 NLSFKFNFFLFYKFCFNNLVKFVMYPFLELKTENFVFNFNFYTNLYDIFLNFKKILLKNF 169 Query: 473 -----VYICF*NEF*CIISKDVFKN--FNL 541 I F N+F + K ++KN FN+ Sbjct: 170 MKLYYFTINFNNKFNYMNKKWLYKNLTFNI 199
>sp|Q9EZK4|SARU_STAAU HTH-type transcriptional regulator sarU (Staphylococcal accessory regulator U) sp|Q5HD55|SARU_STAAC HTH-type transcriptional regulator sarU (Staphylococcal accessory regulator U) Length = 247 Score = 31.6 bits (70), Expect = 2.0 Identities = 35/137 (25%), Positives = 58/137 (42%), Gaps = 17/137 (12%) Frame = +3 Query: 276 KKISCRSRRNDKICQ--------------PNSSNKSYILFVLIVYLSFISKFITKLIFRI 413 KKI+C DKI + P S + +ILF+ I+Y K+ L F Sbjct: 102 KKIACVINELDKIIKGFNKERDYIKYQWAPKYSKEFFILFMNIMYSKDFLKYRFNLTFLD 161 Query: 414 ISASMNYCMTRNNNFNVC*LFTFVFEMNSSV*YPKMYLKTLTYINTAEFLLNNSHL---K 584 +S +N N+ LF + M YP++ ++++ +N L+ L + Sbjct: 162 LSILYVISSRKNEILNLKDLFESIRFM-----YPQI-VRSVNRLNNKGMLIKERSLADER 215 Query: 585 LKLYKLNVIGYYTKLSV 635 + L K+N I Y T S+ Sbjct: 216 IVLIKINKIQYNTIKSI 232
>sp|Q9S597|C27AA_BACUH Pesticidal crystal protein cry27Aa (Insecticidal delta-endotoxin CryXXVIIA(a)) (Crystaline entomocidal protoxin) (94 kDa crystal protein) Length = 826 Score = 31.2 bits (69), Expect = 2.5 Identities = 25/112 (22%), Positives = 47/112 (41%), Gaps = 3/112 (2%) Frame = +1 Query: 1 NTQLGYQNTIREYVREPIDHSKTYLPKLSSEKLSKDIKPELSWYDYTNKKNYKCSTLP-- 174 N L YQ T+ +V + I TY P+L + + +I + D N+ K P Sbjct: 278 NNGLVYQRTMTLFVLDLIAMFSTYDPRLYTMPIKTEILTRTIYTDGVNRNEPKSIHNPGL 337 Query: 175 -NTINVYRRPLTTSQDIGFFHEYNPLLKNLPWMHVKRYPAVQGETTRFVNQI 327 + + + Q F + + +++ + H Y VQG ++ +N+I Sbjct: 338 FRRLEQMKLHIYEYQGAQFLSGHQNIFRSMNYNHPLIYGPVQGYSSSNINKI 389
>sp|P48303|EDG1_RAT Sphingosine 1-phosphate receptor Edg-1 (Sphingosine 1-phosphate receptor 1) (S1P1) Length = 383 Score = 30.0 bits (66), Expect = 5.7 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 600 IYIILILDVNCSAKTRQCLYRLKF 529 ++I+L+LDV C AKT LY+ ++ Sbjct: 273 LFILLLLDVGCKAKTCDILYKAEY 296
>sp|Q8ZIG8|LEU1_YERPE 2-isopropylmalate synthase (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase) sp|Q66EM1|LEU1_YERPS 2-isopropylmalate synthase (Alpha-isopropylmalate synthase) (Alpha-IPM synthetase) Length = 520 Score = 30.0 bits (66), Expect = 5.7 Identities = 19/59 (32%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Frame = -1 Query: 533 SF*IHLWILYTRIHFKNKCKQLTNVEIVISSHTVIHRSRNNTKN-*FSNEFADKT*VDN 360 +F IH+++ + +H ++K K+ + + ++ H+V R+RN T + FS E A +T +DN Sbjct: 93 AFRIHVFLATSTLHIESKLKRSFDDVLAMAVHSV-KRARNYTDDVEFSCEDAGRTPIDN 150
>sp|O08530|EDG1_MOUSE Sphingosine 1-phosphate receptor Edg-1 (Sphingosine 1-phosphate receptor 1) (S1P1) (Lysophospholipid receptor B1) Length = 382 Score = 30.0 bits (66), Expect = 5.7 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -3 Query: 600 IYIILILDVNCSAKTRQCLYRLKF 529 ++I+L+LDV C AKT LY+ ++ Sbjct: 272 LFILLLLDVGCKAKTCDILYKAEY 295
>sp|Q58791|YD96_METJA Hypothetical protein MJ1396 Length = 2894 Score = 29.3 bits (64), Expect = 9.7 Identities = 24/71 (33%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Frame = +3 Query: 366 YLSFISKFI-TKLIFRIISASMNYCMTRNNNFNVC*LFTFVFEMNSSV*YPKMYLKTLTY 542 YL IS F+ T L+ +S +N T NNN N FE+N+S+ Y T T Sbjct: 4 YLKNISIFVFTILLLSNVSLGLNVSTT-NNNSN--------FELNNSLIYKLNNSLTNTT 54 Query: 543 INTAEFLLNNS 575 N+ ++NN+ Sbjct: 55 NNSGSIIINNT 65
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 70,881,155
Number of Sequences: 369166
Number of extensions: 1390495
Number of successful extensions: 3259
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 3162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3255
length of database: 68,354,980
effective HSP length: 106
effective length of database: 48,773,070
effective search space used: 5608903050
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
