DrC_00062
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00062 (1074 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q14978|NOLC1_HUMAN Nucleolar phosphoprotein p130 (Nucleo... 33 1.1 sp|Q8LE10|A22I_ARATH HVA22-like protein i (AtHVA22i) 32 3.1 sp|Q6PCX9|TRI37_MOUSE Tripartite motif protein 37 31 5.3 sp|O94972|TRI37_HUMAN Tripartite motif protein 37 (Mulibrey... 31 5.3
>sp|Q14978|NOLC1_HUMAN Nucleolar phosphoprotein p130 (Nucleolar 130 kDa protein) (140 kDa nucleolar phosphoprotein) (Nopp140) (Nucleolar and coiled-body phosphoprotein 1) Length = 699 Score = 33.5 bits (75), Expect = 1.1 Identities = 19/51 (37%), Positives = 26/51 (50%) Frame = +1 Query: 217 TPKKRTPMKKLFAKSPAKAVDSPVILTNIGTFRLSQSDMTSDSDNDVIEKR 369 TPKK P K++ AK+P KA +P R S S S SD + +K+ Sbjct: 238 TPKKTVPKKQVVAKAPVKAATTPT--------RKSSSSEDSSSDEEEEQKK 280
>sp|Q8LE10|A22I_ARATH HVA22-like protein i (AtHVA22i) Length = 296 Score = 32.0 bits (71), Expect = 3.1 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +1 Query: 202 VAGKETPKKRTPMKK--LFAKSPAKAVDSPVILTNIGTFRLSQSDMTSDSDNDVIEKRRK 375 VA + TP+ + P K+ ++PAK +PV + LS S +S S+N+ E RK Sbjct: 142 VAAQSTPRPQPPQKRGGRANQAPAKPKKAPVPQSEPEEVSLSSSSSSSSSENEGNEPTRK 201 Query: 376 I 378 + Sbjct: 202 V 202
>sp|Q6PCX9|TRI37_MOUSE Tripartite motif protein 37 Length = 961 Score = 31.2 bits (69), Expect = 5.3 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -1 Query: 288 YRAINSFCW*FSKQFLHWCSLFGGFFTGH---QKSIWFKRHAVKLEE 157 + ++ FCW K H C+L+GG GH + +++H K+ E Sbjct: 99 HEKLSVFCWTCKKCICHQCALWGGMHGGHTFKPLAEIYEQHVTKVNE 145
>sp|O94972|TRI37_HUMAN Tripartite motif protein 37 (Mulibrey nanism protein) Length = 964 Score = 31.2 bits (69), Expect = 5.3 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -1 Query: 288 YRAINSFCW*FSKQFLHWCSLFGGFFTGH---QKSIWFKRHAVKLEE 157 + ++ FCW K H C+L+GG GH + +++H K+ E Sbjct: 99 HEKLSVFCWTCKKCICHQCALWGGMHGGHTFKPLAEIYEQHVTKVNE 145
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 109,011,996
Number of Sequences: 369166
Number of extensions: 2060028
Number of successful extensions: 4627
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4444
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4626
length of database: 68,354,980
effective HSP length: 112
effective length of database: 47,664,660
effective search space used: 11677841700
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
