Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_024_D01 (661 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P23382|INA_BACTL Immune inhibitor A precursor 30 5.6 sp|P03110|VL2_PAPVD Minor capsid protein L2 29 9.5
>sp|P23382|INA_BACTL Immune inhibitor A precursor Length = 687 Score = 30.0 bits (66), Expect = 5.6 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 429 SAAAKNRHFFSPSINGNFLNTIFV--QKHRKTVGFRTYL 319 S + +N+ FF +I GN+ N + V +K K +G TYL Sbjct: 311 SFSPQNKEFFQKTIGGNWANIVEVDYEKLNKGIGLATYL 349
>sp|P03110|VL2_PAPVD Minor capsid protein L2 Length = 493 Score = 29.3 bits (64), Expect = 9.5 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +1 Query: 121 ILSETRGRLNIFMEIGGVGAWVFRDCELTYRG 216 I++ET G NIF+ GGVG+ + ELT G Sbjct: 203 IIAETSGSENIFVGGGGVGSTTGEEIELTLFG 234
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,688,347 Number of Sequences: 369166 Number of extensions: 1287351 Number of successful extensions: 3079 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3078 length of database: 68,354,980 effective HSP length: 106 effective length of database: 48,773,070 effective search space used: 5511356910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)