Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00015 (406 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7TUI1|ARLY_PROMP Argininosuccinate lyase (Arginosuccina... 30 2.4 sp|Q04567|YOR3_PRRSL Hypothetical 30.6 kDa protein (ORF3) 29 3.1 sp|Q8DRI4|ARLY_STRR6 Argininosuccinate lyase (Arginosuccina... 29 3.1 sp|P42833|HXT14_YEAST Hexose transporter HXT14 29 3.1 sp|Q5KW95|ARLY_GEOKA Argininosuccinate lyase (Arginosuccina... 29 3.1 sp|Q8ELT9|ARLY_OCEIH Argininosuccinate lyase (Arginosuccina... 29 4.1 sp|P19751|R1AB_CVMJH Replicase polyprotein 1ab (pp1ab) (ORF... 29 4.1 sp|Q9PYA3|R1AB_CVM2 Replicase polyprotein 1ab (pp1ab) (ORF1... 29 4.1 sp|P16342|R1AB_CVMA5 Replicase polyprotein 1ab (pp1ab) (ORF... 28 5.3 sp|Q7VEK0|ARLY_PROMA Argininosuccinate lyase (Arginosuccina... 28 7.0
>sp|Q7TUI1|ARLY_PROMP Argininosuccinate lyase (Arginosuccinase) (ASAL) Length = 459 Score = 29.6 bits (65), Expect = 2.4 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = -1 Query: 280 RQKNPDLTVISKGKTGFLYDHIEQV 206 ++KNPD+ + +GKTG +Y H++ + Sbjct: 282 QKKNPDVPELIRGKTGRVYGHLQSL 306
>sp|Q04567|YOR3_PRRSL Hypothetical 30.6 kDa protein (ORF3) Length = 265 Score = 29.3 bits (64), Expect = 3.1 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 37 CCTFHFQLKNFLQILVIIAWLMASVRRICHWFTVNH 144 C FHF L F+ LV A S +C WF + H Sbjct: 5 CARFHFFLCGFICYLVHSALASNSSSTLCFWFPLAH 40
>sp|Q8DRI4|ARLY_STRR6 Argininosuccinate lyase (Arginosuccinase) (ASAL) Length = 463 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -1 Query: 280 RQKNPDLTVISKGKTGFLYDHI 215 ++KNPD+ + +GKTG +Y H+ Sbjct: 285 QKKNPDMAELIRGKTGRVYGHL 306
>sp|P42833|HXT14_YEAST Hexose transporter HXT14 Length = 540 Score = 29.3 bits (64), Expect = 3.1 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 6/46 (13%) Frame = +1 Query: 202 KTLVRYGHTKIQFYLLI*QL------DQDFSAVVFLGLTCVFIHIF 321 KT + YG T + FY++ + DFS +V + +TC FI F Sbjct: 404 KTCLLYGSTNLLFYMMTYATVGTFGRETDFSNIVLIIVTCCFIFWF 449
>sp|Q5KW95|ARLY_GEOKA Argininosuccinate lyase (Arginosuccinase) (ASAL) Length = 459 Score = 29.3 bits (64), Expect = 3.1 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -1 Query: 280 RQKNPDLTVISKGKTGFLYDHI 215 ++KNPD+ + +GKTG +Y H+ Sbjct: 282 QKKNPDMAELIRGKTGRVYGHL 303
>sp|Q8ELT9|ARLY_OCEIH Argininosuccinate lyase (Arginosuccinase) (ASAL) Length = 459 Score = 28.9 bits (63), Expect = 4.1 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -1 Query: 280 RQKNPDLTVISKGKTGFLYDHI 215 ++KNPD+ + +GKTG +Y H+ Sbjct: 281 QKKNPDVAELVRGKTGRVYGHL 302
>sp|P19751|R1AB_CVMJH Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase (3CL-PRO) (3CLp) (M-PRO) (p27); Unknown protein 1; p10; p22; p12; Growth factor-like peptide (GFL) (p15); RNA-directed RNA polymerase (RdRp) (Pol) (p100); Helicase (Hel) (p67); Unknown protein 2; p35; Unknown protein 3] Length = 7180 Score = 28.9 bits (63), Expect = 4.1 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +1 Query: 58 LKNFLQILVIIAWLMASVRRICHWFTVNHS 147 ++++ Q + ++AWL A++ C+WF + S Sbjct: 3531 VQDYTQTVNVVAWLYAAILNRCNWFVQSDS 3560
>sp|Q9PYA3|R1AB_CVM2 Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase (3CL-PRO) (3CLp) (M-PRO) (p27); Unknown protein 1; p10; p22; p12; Growth factor-like peptide (GFL) (p15); RNA-directed RNA polymerase (RdRp) (Pol) (p100); Helicase (Hel) (p67); Unknown protein 2; p35; Unknown protein 3] Length = 7124 Score = 28.9 bits (63), Expect = 4.1 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +1 Query: 58 LKNFLQILVIIAWLMASVRRICHWFTVNHS 147 ++++ Q + ++AWL A++ C+WF + S Sbjct: 3474 VQDYTQTVNVVAWLYAAILNRCNWFVQSDS 3503
>sp|P16342|R1AB_CVMA5 Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase (3CL-PRO) (3CLp) (M-PRO) (p27); Unknown protein 1; p10; p22; p12; Growth factor-like peptide (GFL) (p15); RNA-directed RNA polymerase (RdRp) (Pol) (p100); Helicase (Hel) (p67); Unknown protein 2; p35; Unknown protein 3] Length = 7176 Score = 28.5 bits (62), Expect = 5.3 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = +1 Query: 58 LKNFLQILVIIAWLMASVRRICHWFTVNHS 147 ++++ Q + ++AWL A++ C+WF + S Sbjct: 3528 VQDYTQTVNVVAWLYAAIFNRCNWFVQSDS 3557
>sp|Q7VEK0|ARLY_PROMA Argininosuccinate lyase (Arginosuccinase) (ASAL) Length = 462 Score = 28.1 bits (61), Expect = 7.0 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = -1 Query: 280 RQKNPDLTVISKGKTGFLYDHIEQV 206 ++KNPD+ + +GKTG ++ H++ + Sbjct: 282 QKKNPDVPELVRGKTGRVFGHLQSL 306
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 48,422,053
Number of Sequences: 369166
Number of extensions: 964937
Number of successful extensions: 1974
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1941
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1973
length of database: 68,354,980
effective HSP length: 98
effective length of database: 50,250,950
effective search space used: 1809034200
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)