Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02997 (337 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O78437|YC44_GUITH HYPOTHETICAL 47.8 KD PROTEIN YCF44 30 1.7 sp|Q00095|KR74_ICHV1 Gene 74 protein kinase 28 6.6
>sp|O78437|YC44_GUITH HYPOTHETICAL 47.8 KD PROTEIN YCF44 Length = 414 Score = 30.0 bits (66), Expect = 1.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 113 SIFQLDWNVSIIVLNIPNFRYYLHPL 190 +I+Q DWN+ +V+ I N YY PL Sbjct: 251 TIYQTDWNIDNLVICIDNQNYYSIPL 276
>sp|Q00095|KR74_ICHV1 Gene 74 protein kinase Length = 673 Score = 28.1 bits (61), Expect = 6.6 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +1 Query: 103 IVLEHFPVGLECINYCIKYPKFSILSSSAVGYCCSTDVD 219 I ++H+ VG+ ++ + Y I+ +SA+G C VD Sbjct: 552 ITIDHYTVGVTNVHLYVGYITDDIVYASAIGLSCPLRVD 590
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,921,235 Number of Sequences: 369166 Number of extensions: 584535 Number of successful extensions: 955 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 68,354,980 effective HSP length: 79 effective length of database: 53,760,915 effective search space used: 1720349280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)