Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02857 (226 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q5L6G2|RNZ_CHLAB Ribonuclease Z (RNase Z) (tRNase Z) (tR... 30 2.2 sp|Q9PK48|RNZ_CHLMU Ribonuclease Z (RNase Z) (tRNase Z) (tR... 29 3.8 sp|P50644|RIR2_EHV4 Ribonucleoside-diphosphate reductase sm... 28 4.9 sp|O84350|RNZ_CHLTR Ribonuclease Z (RNase Z) (tRNase Z) (tR... 28 4.9 sp|Q823T8|RNZ_CHLCV Ribonuclease Z (RNase Z) (tRNase Z) (tR... 28 4.9 sp|O75339|CILP1_HUMAN Cartilage intermediate layer protein ... 28 6.4
>sp|Q5L6G2|RNZ_CHLAB Ribonuclease Z (RNase Z) (tRNase Z) (tRNA 3 endonuclease) Length = 306 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = +1 Query: 106 IIDLSVGMRVRVCECLYLCNWKDEENKHLLEDH 204 I+DL+ R+ +CE YL EE+ HL E H Sbjct: 215 IVDLAKNARIMLCESTYL-----EEHSHLAESH 242
>sp|Q9PK48|RNZ_CHLMU Ribonuclease Z (RNase Z) (tRNase Z) (tRNA 3 endonuclease) Length = 304 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 100 QDIIDLSVGMRVRVCECLYLCNWKDEENKHLLEDH 204 Q I+DL+ R+ +CE YL EE+ HL ++H Sbjct: 213 QAIVDLAKNARILLCESTYL-----EEHAHLAKNH 242
>sp|P50644|RIR2_EHV4 Ribonucleoside-diphosphate reductase small chain (Ribonucleotide reductase small subunit) Length = 320 Score = 28.5 bits (62), Expect = 4.9 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = -1 Query: 142 TLSRAYPRTDLLCLGSDSTATNSF*HNIHRDIKLFLKYSNWARAE 8 T SR Y L+ G+D+TA + ++ +D+ + LK S W +A+ Sbjct: 109 THSRVYSAIQLMLFGNDATARARYVASVVKDVAIDLKVS-WLQAK 152
>sp|O84350|RNZ_CHLTR Ribonuclease Z (RNase Z) (tRNase Z) (tRNA 3 endonuclease) Length = 304 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 100 QDIIDLSVGMRVRVCECLYLCNWKDEENKHLLEDH 204 Q I+DL+ R+ +CE YL EE+ HL + H Sbjct: 213 QAIVDLARNARILLCESTYL-----EEHSHLAKSH 242
>sp|Q823T8|RNZ_CHLCV Ribonuclease Z (RNase Z) (tRNase Z) (tRNA 3 endonuclease) Length = 306 Score = 28.5 bits (62), Expect = 4.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +1 Query: 100 QDIIDLSVGMRVRVCECLYLCNWKDEENKHLLEDH 204 Q ++DL+ R+ +CE YL EE+ HL + H Sbjct: 213 QSVVDLAKDARIMLCESTYL-----EEHLHLAKSH 242
>sp|O75339|CILP1_HUMAN Cartilage intermediate layer protein 1 precursor (CILP-1) (Cartilage intermediate-layer protein) [Contains: Cartilage intermediate layer protein 1 C1; Cartilage intermediate layer protein 1 C2] Length = 1184 Score = 28.1 bits (61), Expect = 6.4 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 9/61 (14%) Frame = +1 Query: 40 RVLCPYGYC---VKRNWSQWSQIQDII----DLSVGMRVRVC--ECLYLCNWKDEENKHL 192 R LCP G +R WS WS V R R+C E + LC+ EE +H Sbjct: 136 RFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHC 195 Query: 193 L 195 + Sbjct: 196 M 196
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,992,082 Number of Sequences: 369166 Number of extensions: 529015 Number of successful extensions: 1550 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1546 length of database: 68,354,980 effective HSP length: 46 effective length of database: 59,857,170 effective search space used: 1676000760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)