Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02848 (929 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase ... 31 5.7 sp|Q650L9|UPPP_BACFR Undecaprenyl-diphosphatase (Undecapren... 30 7.4
>sp|P53008|CWH41_YEAST Mannosyl-oligosaccharide glucosidase (Processing A-glucosidase I) (Glucosidase I) Length = 833 Score = 30.8 bits (68), Expect = 5.7 Identities = 21/71 (29%), Positives = 31/71 (43%) Frame = +1 Query: 373 QVDLYAEDFPYFMSPNYMPKNPELTSIMRYYYDYSYIQCVYTVSSRKNNPFTIKITALSY 552 Q D + +D Y+ P +M N MRYYY + S+ K ++KI LS Sbjct: 732 QDDYFGKDENYWRGPIWMNINYLCLDAMRYYYPEVILDVAGEASNAKKLYQSLKIN-LSN 790 Query: 553 YWYSLWIDNQY 585 Y +W + Y Sbjct: 791 NIYKVWEEQGY 801
>sp|Q650L9|UPPP_BACFR Undecaprenyl-diphosphatase (Undecaprenyl pyrophosphate phosphatase) (Bacitracin resistance protein) Length = 266 Score = 30.4 bits (67), Expect = 7.4 Identities = 30/114 (26%), Positives = 50/114 (43%), Gaps = 3/114 (2%) Frame = -3 Query: 441 FWIFWHIVR*HKVRKVLSIQIDLTIRFIKEFEGSSTICFIFXXXX*GIAIVTISGVDIIF 262 F I H+ +L +ID R + +FE +S ++ I+++ I V + F Sbjct: 44 FTIVVHVATVFSTLVILWKEIDWIFRGLFKFEMNSETRYVINIL---ISMLPIGIVGVFF 100 Query: 261 EQELIVIF-KHLYFDKC--IITSRYQVQSYSAEPTDVHGNWLKDYESIGLQKKC 109 + E+ IF L C ++T+ SY A+P +KD IGL + C Sbjct: 101 KDEVEAIFGSGLLIVGCMLLLTAALLSFSYYAKPRQKENISMKDAFIIGLAQAC 154
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,204,097 Number of Sequences: 369166 Number of extensions: 2180395 Number of successful extensions: 4910 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4910 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 9558791870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)