Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02806 (888 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P30319|DPOL_CBEPV DNA polymerase 31 4.0 sp|P12379|M24_STRPY M protein, serotype 24 precursor 31 4.0 sp|Q8IUD2|RB6I2_HUMAN RAB6 interacting protein 2 (ERC prote... 30 6.9 sp|Q8IYE1|CCDCD_HUMAN Coiled-coil domain-containing protein 13 30 6.9 sp|Q99MI1|RB6I2_MOUSE Rab6 interacting protein 2 (ERC prote... 30 9.0 sp|Q09231|YQ21_CAEEL Hypothetical protein C09F5.1 in chromo... 30 9.0 sp|P18752|ZO72_XENLA Oocyte zinc finger protein XLCOF7.2 30 9.0
>sp|P30319|DPOL_CBEPV DNA polymerase Length = 964 Score = 31.2 bits (69), Expect = 4.0 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +1 Query: 748 KLLIRKVRYLEEKLELNEINSQNCSNNLITMYIDNTDV 861 K L+ K RY++ L LNE N+ + +IT Y N DV Sbjct: 706 KNLVDKSRYIDNNLYLNEQNNPFSNEPVITRYSGNLDV 743
>sp|P12379|M24_STRPY M protein, serotype 24 precursor Length = 539 Score = 31.2 bits (69), Expect = 4.0 Identities = 14/51 (27%), Positives = 31/51 (60%) Frame = +1 Query: 679 ENKILNTNLEELKHDIEIYRNENKLLIRKVRYLEEKLELNEINSQNCSNNL 831 ++++LN N + L+ D++ R K L + + LEE+ +++E + Q+ +L Sbjct: 303 QSQVLNANRQSLRRDLDASREAKKQLEAEHQKLEEQNKISEASRQSLRRDL 353
>sp|Q8IUD2|RB6I2_HUMAN RAB6 interacting protein 2 (ERC protein 1) Length = 1116 Score = 30.4 bits (67), Expect = 6.9 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 652 EEQIKCVICENKILNTNLEELKHDIEIYRNENKLLIRKVRYLEEKLELNE 801 EE+I+ + + EE +E+YR+ +K + KV L+E+L E Sbjct: 402 EEEIQMLKSNGALSTEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKE 451
>sp|Q8IYE1|CCDCD_HUMAN Coiled-coil domain-containing protein 13 Length = 715 Score = 30.4 bits (67), Expect = 6.9 Identities = 15/46 (32%), Positives = 27/46 (58%) Frame = +1 Query: 652 EEQIKCVICENKILNTNLEELKHDIEIYRNENKLLIRKVRYLEEKL 789 +E ++ + E +L LEELK E R+ NKLL +++ L+ ++ Sbjct: 325 QEGLEKLASERDVLQRELEELKKKFEGMRSRNKLLSSEMKTLKSQM 370
>sp|Q99MI1|RB6I2_MOUSE Rab6 interacting protein 2 (ERC protein 1) (ERC1) (CAZ-associated structural protein 2) (CAST2) Length = 1120 Score = 30.0 bits (66), Expect = 9.0 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +1 Query: 652 EEQIKCVICENKILNTNLEELKHDIEIYRNENKLLIRKVRYLEEKLELNEINSQ 813 EE+I+ + + + EE +E+YR+ +K + KV L+E+L + + Sbjct: 402 EEEIQMLKSNGALSSEEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKDAQGE 455
>sp|Q09231|YQ21_CAEEL Hypothetical protein C09F5.1 in chromosome III Length = 571 Score = 30.0 bits (66), Expect = 9.0 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -3 Query: 166 EKTPK*LINLCCILYPLAFILKLYFVLF 83 E TP+ L +LCCIL L +L L F++F Sbjct: 278 EYTPELLRSLCCILLLLLLLLFLMFIIF 305
>sp|P18752|ZO72_XENLA Oocyte zinc finger protein XLCOF7.2 Length = 391 Score = 30.0 bits (66), Expect = 9.0 Identities = 22/55 (40%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Frame = +1 Query: 733 YRNENKLLIRKVRYL--EEKLELNEINSQNCSNNLITMYIDNTDV---ILYSSLF 882 YR N LL + EE EIN NCS N +T I TD I+ SLF Sbjct: 157 YRMNNSLLENYISNAIKEETASCEEINQSNCSINPLTEQIQGTDTPTPIMGYSLF 211
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,734,829 Number of Sequences: 369166 Number of extensions: 1442309 Number of successful extensions: 3926 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3786 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3924 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 8886314050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)