Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02805 (216 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q39472|IDI1_CLABR Isopentenyl-diphosphate delta-isomeras... 28 6.5 sp|Q38929|IDI1_ARATH Isopentenyl-diphosphate delta-isomeras... 28 6.5 sp|O48965|IDI2_CAMAC Isopentenyl-diphosphate delta-isomeras... 28 6.5 sp|Q42553|IDI2_ARATH Isopentenyl-diphosphate delta-isomeras... 28 8.5 sp|P39523|YM11_YEAST Hypothetical 105.9 kDa protein in RPL1... 28 8.5 sp|Q17232|OAR_BOMMO Octopamine receptor 28 8.5 sp|Q51506|SOXR_PSEAE Redox-sensitive transcriptional activa... 28 8.5 sp|P36124|SET3_YEAST SET domain protein 3 28 8.5 sp|Q39664|IDI2_CLAXA Isopentenyl-diphosphate delta-isomeras... 28 8.5 sp|Q39471|IDI2_CLABR Isopentenyl-diphosphate delta-isomeras... 28 8.5
>sp|Q39472|IDI1_CLABR Isopentenyl-diphosphate delta-isomerase I (IPP isomerase I) (Isopentenyl pyrophosphate isomerase I) Length = 287 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 107 QWNESYKHEIDYMIFVLRDV 48 +W E HE+DY++F++RDV Sbjct: 199 KWGE---HELDYLLFIIRDV 215
>sp|Q38929|IDI1_ARATH Isopentenyl-diphosphate delta-isomerase I (IPP isomerase I) (Isopentenyl pyrophosphate isomerase I) Length = 233 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 107 QWNESYKHEIDYMIFVLRDV 48 +W E HE+DY++F++RDV Sbjct: 145 KWGE---HEVDYLLFIVRDV 161
>sp|O48965|IDI2_CAMAC Isopentenyl-diphosphate delta-isomerase II (IPP isomerase II) (Isopentenyl pyrophosphate isomerase II) Length = 309 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 107 QWNESYKHEIDYMIFVLRDV 48 +W E HE+DY++F++RDV Sbjct: 220 KWGE---HELDYLLFIIRDV 236
>sp|Q42553|IDI2_ARATH Isopentenyl-diphosphate delta-isomerase II (IPP isomerase II) (Isopentenyl pyrophosphate isomerase II) Length = 284 Score = 27.7 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 107 QWNESYKHEIDYMIFVLRDV 48 +W E HE+DY++F++RDV Sbjct: 196 KWGE---HELDYLLFIVRDV 212
>sp|P39523|YM11_YEAST Hypothetical 105.9 kDa protein in RPL15B-GCR3 intergenic region Length = 943 Score = 27.7 bits (60), Expect = 8.5 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 9/62 (14%) Frame = +2 Query: 26 PIKFSRRKHPVKRRSYSQSH---------VYNSHSIEIPILSKQNSLECLNNSYDNYNSK 178 PI+ ++ + ++YSQ N H EIP++ + L+N+ DN N K Sbjct: 76 PIQAPLQQRQIPMQNYSQQQRQQQQYNFEYSNPHMNEIPLMQHNFTKPSLSNNRDNVNGK 135 Query: 179 ES 184 ++ Sbjct: 136 KA 137
>sp|Q17232|OAR_BOMMO Octopamine receptor Length = 479 Score = 27.7 bits (60), Expect = 8.5 Identities = 19/57 (33%), Positives = 31/57 (54%) Frame = +2 Query: 23 RPIKFSRRKHPVKRRSYSQSHVYNSHSIEIPILSKQNSLECLNNSYDNYNSKESKIS 193 R K + +K P KRR +S+ ++ I IPILS +NS+ + + +N N+ S Sbjct: 301 RTRKLTPKKKP-KRRYWSKDDKSHNKLI-IPILSNENSVTDIGENLENRNTSSESNS 355
>sp|Q51506|SOXR_PSEAE Redox-sensitive transcriptional activator soxR Length = 156 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 125 WIKLEFQWNESYKHEIDYMIFVLRDVFDGKI 33 W +L QW E ID ++ +LRD DG I Sbjct: 89 WARLSAQWKEDLTERIDKLL-LLRDQLDGCI 118
>sp|P36124|SET3_YEAST SET domain protein 3 Length = 751 Score = 27.7 bits (60), Expect = 8.5 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 5/66 (7%) Frame = +2 Query: 11 NELSRPIKFSRRKHPV---KRRSYSQSHVYNSHSIEIPILSKQN--SLECLNNSYDNYNS 175 + +S P K + P+ K Y +SH+ N + IP+L N S + N+ ++ + Sbjct: 615 SNISVPKKNETSEKPLIITKSTDYDESHITNIEELPIPVLLPINKTSRQTANDVEESQSK 674 Query: 176 KESKIS 193 E K+S Sbjct: 675 NEHKLS 680
>sp|Q39664|IDI2_CLAXA Isopentenyl-diphosphate delta-isomerase II (IPP isomerase II) (Isopentenyl pyrophosphate isomerase II) Length = 290 Score = 27.7 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 107 QWNESYKHEIDYMIFVLRDV 48 +W E HE+DY++F++RDV Sbjct: 202 KWGE---HELDYLLFIVRDV 218
>sp|Q39471|IDI2_CLABR Isopentenyl-diphosphate delta-isomerase II (IPP isomerase II) (Isopentenyl pyrophosphate isomerase II) Length = 286 Score = 27.7 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = -2 Query: 107 QWNESYKHEIDYMIFVLRDV 48 +W E HE+DY++F++RDV Sbjct: 198 KWGE---HELDYLLFIVRDV 214
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,947,817 Number of Sequences: 369166 Number of extensions: 381047 Number of successful extensions: 1103 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 68,354,980 effective HSP length: 43 effective length of database: 60,411,375 effective search space used: 1691518500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)