Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02741 (417 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P48920|NU5M_CHOCR NADH-ubiquinone oxidoreductase chain 5... 29 3.4 sp|O13947|TRMU_SCHPO Probable tRNA (5-methylaminomethyl-2-t... 28 7.5
>sp|P48920|NU5M_CHOCR NADH-ubiquinone oxidoreductase chain 5 (NADH dehydrogenase subunit 5) Length = 666 Score = 29.3 bits (64), Expect = 3.4 Identities = 14/51 (27%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -2 Query: 179 FWGQNFIQIR*SNLT---FINVYXXXXXXXXFIYSCCKCNYNTYLLYFTIF 36 FW Q I+++ +T F ++ +YS +N LL+FT+F Sbjct: 613 FWSQILIKLQTGQITHYLFFMIFTFCSFSIILVYSYINLTFNLLLLFFTLF 663
>sp|O13947|TRMU_SCHPO Probable tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Length = 415 Score = 28.1 bits (61), Expect = 7.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 159 NKILPPKTTLYENGITDNCSIQMTASVKGG 248 N + P LYENG+T N + VK G Sbjct: 107 NLVFEPSLDLYENGLTPNPDVSCNRQVKFG 136
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,682,845 Number of Sequences: 369166 Number of extensions: 324348 Number of successful extensions: 564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 564 length of database: 68,354,980 effective HSP length: 99 effective length of database: 50,066,215 effective search space used: 1952582385 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)