Planaria EST Database


DrC_02475

BLASTX 2.2.13 [Nov-27-2005]

Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= DrC_02475
         (485 letters)

Database: Non-redundant SwissProt sequences 
           184,735 sequences; 68,354,980 total letters



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|Q02595|KPK2_PLAFK  Probable serine/threonine-protein kina...    30   3.9  
>sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2
          Length = 510

 Score = 29.6 bits (65), Expect = 3.9
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 3/65 (4%)
 Frame = +3

Query: 6   PILMDLELTLIEAKIKSGDCIILKRIEESLACKKIKL---DCTEEIVKNESKNDQPVVNE 176
           P L D+ +T    ++K  + I+ K  ++   CKK K       ++I  N + N+Q   N+
Sbjct: 366 PKLTDMHMTANINELKRNEAIVHKSNDQQDMCKKCKHFNNTQNDDIYNNNNNNNQLDPNK 425

Query: 177 NNDEN 191
           N+  N
Sbjct: 426 NHKNN 430
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,742,519
Number of Sequences: 369166
Number of extensions: 825824
Number of successful extensions: 2273
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2217
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2273
length of database: 68,354,980
effective HSP length: 102
effective length of database: 49,512,010
effective search space used: 2921208590
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)