Dr_sW_020_N05
- ACCESSION : BW641282
- GO Category :
Not Available
- EST Sequence :
BLASTX 2.2.12 [Aug-07-2005]
Reference:
Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= Dr_sW_020_N05
(485 letters)
Database: Non-redundant SwissProt sequences
184,735 sequences; 68,354,980 total letters
Score E
Sequences producing significant alignments: (bits) Value
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kina... 30 3.9
>sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2
Length = 510
Score = 29.6 bits (65), Expect = 3.9
Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 3/65 (4%)
Frame = +3
Query: 6 PILMDLELTLIEAKIKSGDCIILKRIEESLACKKIKL---DCTEEIVKNESKNDQPVVNE 176
P L D+ +T ++K + I+ K ++ CKK K ++I N + N+Q N+
Sbjct: 366 PKLTDMHMTANINELKRNEAIVHKSNDQQDMCKKCKHFNNTQNDDIYNNNNNNNQLDPNK 425
Query: 177 NNDEN 191
N+ N
Sbjct: 426 NHKNN 430
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 47,742,519
Number of Sequences: 369166
Number of extensions: 825824
Number of successful extensions: 2273
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2217
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2273
length of database: 68,354,980
effective HSP length: 102
effective length of database: 49,512,010
effective search space used: 2921208590
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)