Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02398 (404 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9FK59|IFE3_ARATH Eukaryotic translation initiation fact... 28 7.0 sp|P57679|EVC_HUMAN Ellis-van Creveld syndrome protein (DWF-1) 28 9.1
>sp|Q9FK59|IFE3_ARATH Eukaryotic translation initiation factor 4E type 3 (eIF4E type 3) (eIF-4E type 3) (mRNA cap-binding protein type 3) (Novel cap-binding protein) (nCBP) Length = 221 Score = 28.1 bits (61), Expect = 7.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 73 YRDISEASWQRAQYCNGGRWWFRYGKL 153 ++D W+ CNGG+W R+ K+ Sbjct: 103 FKDGIRPLWEDGANCNGGKWIIRFSKV 129
>sp|P57679|EVC_HUMAN Ellis-van Creveld syndrome protein (DWF-1) Length = 992 Score = 27.7 bits (60), Expect = 9.1 Identities = 13/47 (27%), Positives = 28/47 (59%) Frame = +2 Query: 8 YQDMETNQMLKHDQSFAENRHDTGTFPRRRGKELNIVMEEDGGSDTE 148 +Q +T +LK+ +S A+ +TG+ RRR +E+ + +++ + E Sbjct: 57 HQKDDTQNLLKNLESNAQTPSETGSPSRRRKREVQMSKDKEAVDECE 103
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,211,194 Number of Sequences: 369166 Number of extensions: 687981 Number of successful extensions: 1716 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1716 length of database: 68,354,980 effective HSP length: 98 effective length of database: 50,250,950 effective search space used: 1809034200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)