Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_02058 (427 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|O14530|TXND9_HUMAN Thioredoxin domain containing protein... 49 3e-06 sp|Q9CQ79|TXND9_MOUSE Thioredoxin domain containing protein... 49 3e-06 sp|Q8K581|TXND9_RAT Thioredoxin domain containing protein 9... 49 3e-06 sp|O18883|TXND9_BOVIN Thioredoxin domain containing protein... 45 6e-05 sp|O64628|14P_ARATH UPF0071 protein At2g18990 39 0.005 sp|Q11183|YPD3_CAEEL Hypothetical UPF0071 protein C05D11.3 ... 30 2.8
>sp|O14530|TXND9_HUMAN Thioredoxin domain containing protein 9 (Protein 1-4) (ATP binding protein associated with cell differentiation) Length = 226 Score = 49.3 bits (116), Expect = 3e-06 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 4/55 (7%) Frame = +2 Query: 2 LGGHDEFSTKMMEWRIAQADVINYSGDLLTPPDIKPKSGILGVN----KKKAIRG 154 LG D+F+T+ +EWR+ +D++NYSG+L+ PP K G N +KK IRG Sbjct: 164 LGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKK--FGTNFTKLEKKTIRG 216
>sp|Q9CQ79|TXND9_MOUSE Thioredoxin domain containing protein 9 (ATP binding protein associated with cell differentiation) Length = 226 Score = 49.3 bits (116), Expect = 3e-06 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 4/55 (7%) Frame = +2 Query: 2 LGGHDEFSTKMMEWRIAQADVINYSGDLLTPPDIKPKSGILGVN----KKKAIRG 154 LG D+F+T+ +EWR+ +DVINYSG+L+ PP K G N +KK IRG Sbjct: 164 LGNTDDFTTETLEWRLGCSDVINYSGNLMEPPFQSQKK--FGTNFTKLEKKTIRG 216
>sp|Q8K581|TXND9_RAT Thioredoxin domain containing protein 9 (ES cell-related protein) Length = 226 Score = 49.3 bits (116), Expect = 3e-06 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 4/55 (7%) Frame = +2 Query: 2 LGGHDEFSTKMMEWRIAQADVINYSGDLLTPPDIKPKSGILGVN----KKKAIRG 154 LG D+F+T+ +EWR+ +DVINYSG+L+ PP K G N +KK IRG Sbjct: 164 LGNTDDFTTETLEWRLGCSDVINYSGNLMEPPFQSQKK--FGTNFTKLEKKTIRG 216
>sp|O18883|TXND9_BOVIN Thioredoxin domain containing protein 9 (Protein 1-4) Length = 179 Score = 45.1 bits (105), Expect = 6e-05 Identities = 16/32 (50%), Positives = 26/32 (81%) Frame = +2 Query: 2 LGGHDEFSTKMMEWRIAQADVINYSGDLLTPP 97 LG D+F+T+ +EWR+ +D++NYSG+L+ PP Sbjct: 94 LGNTDDFTTETLEWRLGCSDILNYSGNLMEPP 125
>sp|O64628|14P_ARATH UPF0071 protein At2g18990 Length = 211 Score = 38.9 bits (89), Expect = 0.005 Identities = 20/38 (52%), Positives = 27/38 (71%) Frame = +2 Query: 2 LGGHDEFSTKMMEWRIAQADVINYSGDLLTPPDIKPKS 115 LGG D+FST+ +E RIA+A VI+Y G+ +KPKS Sbjct: 158 LGGKDDFSTEDLEERIARAQVIHYDGE---SSSLKPKS 192
>sp|Q11183|YPD3_CAEEL Hypothetical UPF0071 protein C05D11.3 in chromosome III Length = 208 Score = 29.6 bits (65), Expect = 2.8 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = +2 Query: 2 LGGHDEFSTKMMEWRIAQADVI 67 LGG DEF+T+ ME R+A+++V+ Sbjct: 159 LGGKDEFTTETMENRLARSEVL 180
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,552,759 Number of Sequences: 369166 Number of extensions: 609911 Number of successful extensions: 1169 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1169 length of database: 68,354,980 effective HSP length: 99 effective length of database: 50,066,215 effective search space used: 2102781030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)