Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01712 (556 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q8D2H9|MINC_WIGBR Probable septum site-determining prote... 30 4.0 sp|P53119|HUL5_YEAST Probable ubiquitin--protein ligase HUL5 29 8.9 sp|P24499|ATP6_TRYBB ATP synthase a chain (ATPase protein 6) 29 8.9
>sp|Q8D2H9|MINC_WIGBR Probable septum site-determining protein minC Length = 243 Score = 30.0 bits (66), Expect = 4.0 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +2 Query: 359 KYLIKNKACFNY*FNNFQKLIFKKLMFSIMEKDIFPNK*TANNLLKNY 502 KY + NK C + NF L+ ++ I EK+I+ T N +KN+ Sbjct: 11 KYFMFNKVCLKFKIKNFNILVI--YLYDIKEKNIYK---TIKNKIKNF 53
>sp|P53119|HUL5_YEAST Probable ubiquitin--protein ligase HUL5 Length = 910 Score = 28.9 bits (63), Expect = 8.9 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -2 Query: 108 EKLCIFNSFFSQNRLRLSLKIDYNFLNFYFQWS 10 E++ +F F + ++ RLSL D+N +N + W+ Sbjct: 515 ERVDLFYMFIALDKKRLSLDDDHNLINMFTPWA 547
>sp|P24499|ATP6_TRYBB ATP synthase a chain (ATPase protein 6) Length = 229 Score = 28.9 bits (63), Expect = 8.9 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +2 Query: 314 LFFFQNLVFLSV*LIKYLIKNKACFNY*FNNFQKLIFKKLMFSIMEKDIF 463 LFFF +L +L + L Y ++ CF FN LIF L+F + + +F Sbjct: 3 LFFFCDLFWLRLLLCMYYCVSRLCFIVYFNCLM-LIFDFLLFCLFDLYLF 51
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,671,939 Number of Sequences: 369166 Number of extensions: 630514 Number of successful extensions: 967 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 954 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 967 length of database: 68,354,980 effective HSP length: 104 effective length of database: 49,142,540 effective search space used: 3931403200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)