Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01644 (543 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q09266|YQD6_CAEEL Hypothetical protein C32D5.6 in chromo... 29 8.4 sp|Q8I8U7|TRA1_DROME Transcription-associated protein 1 (dT... 29 8.4 sp|P59496|END4_BUCBP Probable endonuclease IV (Endodeoxyrib... 29 8.4
>sp|Q09266|YQD6_CAEEL Hypothetical protein C32D5.6 in chromosome II Length = 578 Score = 28.9 bits (63), Expect = 8.4 Identities = 16/62 (25%), Positives = 27/62 (43%) Frame = -2 Query: 494 NFSYFLKN*TCFVEQTQTLQHCQTRWFFPSIWKNNHNHVVEKYFSNNNLSANITSCNVKW 315 NF+ F+K QT ++C+ PS+W + V E++ S + S + Sbjct: 158 NFASFIKGALNIRTCYQTYRYCEKLMNEPSVWVGRNKKVQEQFESGTRMGLGTFSLMLSV 217 Query: 314 LP 309 LP Sbjct: 218 LP 219
>sp|Q8I8U7|TRA1_DROME Transcription-associated protein 1 (dTRA1) Length = 3803 Score = 28.9 bits (63), Expect = 8.4 Identities = 12/52 (23%), Positives = 28/52 (53%) Frame = +2 Query: 8 EFMSIMGKKPIMVSFLSKAVRAGDQTSCRKSIHEGQYIPWSIWFDGWNEVFV 163 EF ++ G ++++ + ++ AG S +H+G W++W D ++F+ Sbjct: 3031 EFYALKG---LLLAQIGRSEEAGKSFSVAAQLHDGLTKAWAMWGDYMEQIFL 3079
>sp|P59496|END4_BUCBP Probable endonuclease IV (Endodeoxyribonuclease IV) Length = 278 Score = 28.9 bits (63), Expect = 8.4 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = -2 Query: 395 NNHNHVVEKYFSNNNLSANITSCNVKWLPIIYTTNNSSIWYD 270 + H+++ + Y +++ I + N K P+I T N+ +W D Sbjct: 229 DRHHNLGQGYIGKSSIRWIIRNINFKLFPMILETTNNKLWKD 270
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,969,296 Number of Sequences: 369166 Number of extensions: 1464282 Number of successful extensions: 4052 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4044 length of database: 68,354,980 effective HSP length: 104 effective length of database: 49,142,540 effective search space used: 3734833040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)