Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01591 (463 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q90839|DKK3_CHICK Dickkopf-related protein 3 precursor (... 32 0.53 sp|O54890|ITB3_MOUSE Integrin beta-3 precursor (Platelet me... 32 0.69 sp|P05106|ITB3_HUMAN Integrin beta-3 precursor (Platelet me... 32 0.90 sp|Q9UBP4|DKK3_HUMAN Dickkopf-related protein 3 precursor (... 32 0.90 sp|P53813|PROS_RAT Vitamin K-dependent protein S precursor 31 1.5 sp|P98118|PROS_RABIT Vitamin K-dependent protein S precursor 31 1.5 sp|P97776|ADA18_RAT ADAM 18 (A disintegrin and metalloprote... 31 1.5 sp|Q9Y219|JAG2_HUMAN Jagged-2 precursor (Jagged2) (HJ2) 30 2.0 sp|Q9QUN9|DKK3_MOUSE Dickkopf-related protein 3 precursor (... 30 2.6 sp|P24787|NEUV_CHICK Vasotocin-neurophysin VT precursor [Co... 30 2.6
>sp|Q90839|DKK3_CHICK Dickkopf-related protein 3 precursor (Dkk-3) (Dickkopf-3) (Lens fiber protein CLFEST4) Length = 350 Score = 32.3 bits (72), Expect = 0.53 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = +3 Query: 114 CEFENGFCFAHDQCCGNLMCKIVNDFGQCSTVNLNEIHKAGVPCRSHNDCGANMCC 281 C+ ++ C +CCG+ +C +G+C + G C + +DC CC Sbjct: 163 CKTQHTHCSRDVECCGDQLCV----WGECRKATSRG--ENGTICENQHDCNPGTCC 212
>sp|O54890|ITB3_MOUSE Integrin beta-3 precursor (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD61 antigen) Length = 787 Score = 32.0 bits (71), Expect = 0.69 Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 5/95 (5%) Frame = +3 Query: 120 FENGFCFAHDQC-CGNLMCKI--VNDFGQCSTVNLNEIHKAGVPC--RSHNDCGANMCCF 284 ++ C H QC CG+ +C + C+T + G+ C R + +CG+ +C Sbjct: 556 YKGEMCSGHGQCNCGDCVCDSDWTGYYCNCTTRTDTCMSTNGLLCSGRGNCECGSCVCVQ 615 Query: 285 SDTYGTGQREIRTCHNAIGQTCESHTKIKNDKMFN 389 +YG + TC +A C + K FN Sbjct: 616 PGSYGDTCEKCPTCPDA----CSFKKECVECKKFN 646
>sp|P05106|ITB3_HUMAN Integrin beta-3 precursor (Platelet membrane glycoprotein IIIa) (GPIIIa) (CD61 antigen) Length = 788 Score = 31.6 bits (70), Expect = 0.90 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 5/77 (6%) Frame = +3 Query: 120 FENGFCFAHDQC-CGNLMCKI--VNDFGQCSTVNLNEIHKAGVPC--RSHNDCGANMCCF 284 ++ C H QC CG+ +C + C+T + G+ C R +CG+ +C Sbjct: 557 YKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQ 616 Query: 285 SDTYGTGQREIRTCHNA 335 +YG + TC +A Sbjct: 617 PGSYGDTCEKCPTCPDA 633
>sp|Q9UBP4|DKK3_HUMAN Dickkopf-related protein 3 precursor (Dkk-3) (Dickkopf-3) (hDkk-3) Length = 350 Score = 31.6 bits (70), Expect = 0.90 Identities = 14/56 (25%), Positives = 24/56 (42%) Frame = +3 Query: 114 CEFENGFCFAHDQCCGNLMCKIVNDFGQCSTVNLNEIHKAGVPCRSHNDCGANMCC 281 C + C +CCG+ +C +G C+ + + G C + DC +CC Sbjct: 171 CRGQRMLCTRDSECCGDQLCV----WGHCTKMATRGSN--GTICDNQRDCQPGLCC 220
>sp|P53813|PROS_RAT Vitamin K-dependent protein S precursor Length = 675 Score = 30.8 bits (68), Expect = 1.5 Identities = 15/72 (20%), Positives = 29/72 (40%) Frame = +3 Query: 63 FKCQHELAKLVLENEAKCEFENGFCFAHDQCCGNLMCKIVNDFGQCSTVNLNEIHKAGVP 242 + C ++ +L N+ C+ + C CG +CK + +C N + Sbjct: 182 YHCSCKIGFAMLTNKKDCK-DVDECSLKPSVCGTAVCKNIPGDFECECPNGYRYDPSSKS 240 Query: 243 CRSHNDCGANMC 278 C+ ++C N C Sbjct: 241 CKDVDECSENTC 252
>sp|P98118|PROS_RABIT Vitamin K-dependent protein S precursor Length = 646 Score = 30.8 bits (68), Expect = 1.5 Identities = 16/72 (22%), Positives = 27/72 (37%) Frame = +3 Query: 63 FKCQHELAKLVLENEAKCEFENGFCFAHDQCCGNLMCKIVNDFGQCSTVNLNEIHKAGVP 242 + C + ++L NE C+ + C CG +CK +C + Sbjct: 153 YHCSCKSGFVMLANEKDCK-DMDECSVKPSVCGTAVCKNTPGDFECECSEGYRYNPTAKS 211 Query: 243 CRSHNDCGANMC 278 C ++C NMC Sbjct: 212 CEDIDECSENMC 223
>sp|P97776|ADA18_RAT ADAM 18 (A disintegrin and metalloproteinase domain 18) (Transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein III) (tMDC III) Length = 445 Score = 30.8 bits (68), Expect = 1.5 Identities = 23/78 (29%), Positives = 33/78 (42%), Gaps = 13/78 (16%) Frame = +3 Query: 102 NEAKCEFENGFCFAHDQCCGNLMCKIVND----FGQCSTVNLNEIHKAGVPCRSHND--C 263 NE +C+F+ +CC + CK+ G C T E+ AG PCR D C Sbjct: 131 NETECQFK--------ECCNHETCKLKGSAQCGSGTCCTPKC-ELSAAGTPCRKAVDPEC 181 Query: 264 -------GANMCCFSDTY 296 G++ C DT+ Sbjct: 182 DFTEYCDGSSSHCVPDTF 199
>sp|Q9Y219|JAG2_HUMAN Jagged-2 precursor (Jagged2) (HJ2) Length = 1238 Score = 30.4 bits (67), Expect = 2.0 Identities = 25/108 (23%), Positives = 41/108 (37%), Gaps = 8/108 (7%) Frame = +3 Query: 57 NGFKCQHELAKLVLENEAKCEFENGF----CFAHDQCCGNLMCKIVNDFGQCSTVNLNEI 224 NG +C + LE + C + F C + C C++++ G + + Sbjct: 547 NGARCYN------LEGDYYCACPDDFGGKNCSVprePCPGGACRVIDGCGSDAGPGMPGT 600 Query: 225 HKAGVPCRSHNDC----GANMCCFSDTYGTGQREIRTCHNAIGQTCES 356 +GV C H C G N C D+ TG + +GQ C + Sbjct: 601 AASGV-CGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRN 647
>sp|Q9QUN9|DKK3_MOUSE Dickkopf-related protein 3 precursor (Dkk-3) (Dickkopf-3) (mDkk-3) Length = 349 Score = 30.0 bits (66), Expect = 2.6 Identities = 14/56 (25%), Positives = 23/56 (41%) Frame = +3 Query: 114 CEFENGFCFAHDQCCGNLMCKIVNDFGQCSTVNLNEIHKAGVPCRSHNDCGANMCC 281 C + C +CCG+ +C +G C+ + G C + DC +CC Sbjct: 171 CRDQQMLCTRDSECCGDQLCA----WGHCTQKATKGGN--GTICDNQRDCQPGLCC 220
>sp|P24787|NEUV_CHICK Vasotocin-neurophysin VT precursor [Contains: Vasotocin (VT); Neurophysin VT] Length = 161 Score = 30.0 bits (66), Expect = 2.6 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = +3 Query: 129 GFCFAHDQCCG-NLMCKI-VNDFGQCSTVNL--NEIHKAGVPCRSHNDCGAN-MCCFSDT 293 G CF CCG L C + + +C+ + + G PC S C AN +CC +DT Sbjct: 50 GRCFGPGICCGAELGCYLGTAETRRCAEEDYMPSPCQAGGQPCGSDGRCAANGVCCSADT 109
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,013,946 Number of Sequences: 369166 Number of extensions: 1050396 Number of successful extensions: 2986 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2984 length of database: 68,354,980 effective HSP length: 101 effective length of database: 49,696,745 effective search space used: 2584230740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)