Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01521 (946 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q09108|SCF_CHICK Kit ligand precursor (C-kit ligand) (St... 30 7.6 sp|P40469|MET18_YEAST DNA repair/transcription protein MET1... 30 9.9
>sp|Q09108|SCF_CHICK Kit ligand precursor (C-kit ligand) (Stem cell factor) (SCF) (Mast cell growth factor) (MGF) Length = 287 Score = 30.4 bits (67), Expect = 7.6 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = -2 Query: 621 QKFQDSSNSSDSIPYLKITEILSSVFFKRIYKDIFSKRKL*IKKNFNCFE*SR*IVENF 445 QKF D S+ SD + I L+ + + F K K IK+N + +E R I ENF Sbjct: 86 QKFSDISDMSDVLSNYSIINNLTRIINDLMACLAFDKNKDFIKENGHLYEEDRFIPENF 144
>sp|P40469|MET18_YEAST DNA repair/transcription protein MET18/MMS19 Length = 1032 Score = 30.0 bits (66), Expect = 9.9 Identities = 19/60 (31%), Positives = 33/60 (55%) Frame = +3 Query: 675 FIAKFQFLFGFVKFISRRELHSLL*KDSSKVYKDHLSLQQILNNKWVLRKEVYLVIKWED 854 F KF LFG V+ + + H+ ++ K+ +L L +L+NK+V K+V + W+D Sbjct: 732 FPQKFTVLFGTVQLLKK---HAPRMTETEKL--GYLELLLVLSNKFVSEKDVIGLFDWKD 786
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,337,883 Number of Sequences: 369166 Number of extensions: 1473182 Number of successful extensions: 3025 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3023 length of database: 68,354,980 effective HSP length: 110 effective length of database: 48,034,130 effective search space used: 9798962520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)