Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01499 (271 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P43571|YFC5_YEAST Hypothetical 117.8 kDa protein in STE2... 29 3.9 sp|P31042|CD28_RAT T-cell-specific surface glycoprotein CD2... 28 8.7 sp|P31041|CD28_MOUSE T-cell-specific surface glycoprotein C... 28 8.7
>sp|P43571|YFC5_YEAST Hypothetical 117.8 kDa protein in STE2-FRS2 intergenic region Length = 1029 Score = 28.9 bits (63), Expect = 3.9 Identities = 15/53 (28%), Positives = 31/53 (58%) Frame = +2 Query: 53 CLKSFLLKLINSQRSVFLLSM*IINQL*LYNTTRAIIYAYRS*MNLSLLVVYL 211 C++ LLKL N+++ + LL+ YN T ++ + S +N+ +++V+L Sbjct: 897 CIRVALLKLSNNEQKLNLLN---------YNMTLLLLLLFVSAINIPIIIVFL 940
>sp|P31042|CD28_RAT T-cell-specific surface glycoprotein CD28 precursor Length = 218 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 25 YSYKLSTIELSKIVFVKVNKFTAICISTFNVNYQP 129 YSY L E ++ VN +C+ N YQP Sbjct: 43 YSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQP 77
>sp|P31041|CD28_MOUSE T-cell-specific surface glycoprotein CD28 precursor Length = 218 Score = 27.7 bits (60), Expect = 8.7 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 25 YSYKLSTIELSKIVFVKVNKFTAICISTFNVNYQP 129 YSY L E ++ VN +C+ N YQP Sbjct: 43 YSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQP 77
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,185,395 Number of Sequences: 369166 Number of extensions: 391577 Number of successful extensions: 932 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 932 length of database: 68,354,980 effective HSP length: 59 effective length of database: 57,455,615 effective search space used: 1723668450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)