Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01383 (852 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9ZTX8|ARFF_ARATH Auxin response factor 6 32 2.9 sp|P16076|MYODB_XENLA Myoblast determination protein 1 homo... 30 8.5
>sp|Q9ZTX8|ARFF_ARATH Auxin response factor 6 Length = 933 Score = 31.6 bits (70), Expect = 2.9 Identities = 24/70 (34%), Positives = 31/70 (44%), Gaps = 9/70 (12%) Frame = +2 Query: 260 GRLTNLPPLAQR--RFPQSSGLNLLASVADSISHHDPNLPSV-------LHRVSNLRDIS 412 G L +LPP+ R FPQ + AS + H PN PS+ LH V+ D+ Sbjct: 30 GPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPSLHPQLICQLHNVTMHADV- 88 Query: 413 EGDPCSPQST 442 E D Q T Sbjct: 89 ETDEVYAQMT 98
>sp|P16076|MYODB_XENLA Myoblast determination protein 1 homolog B (Myogenic factor 25) Length = 287 Score = 30.0 bits (66), Expect = 8.5 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +2 Query: 311 SGLNLLASVADSISHHDPNLPSVLHRVSNLRDISEGDPCSP 433 S L+ L+S+ + IS P+ P+ + S SEG PCSP Sbjct: 216 SSLDCLSSIVERISTQSPSCPAPISVDSG----SEGSPCSP 252
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,962,547 Number of Sequences: 369166 Number of extensions: 1441471 Number of successful extensions: 3375 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3373 length of database: 68,354,980 effective HSP length: 109 effective length of database: 48,218,865 effective search space used: 8390082510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)