Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01379 (276 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9QZM6|NCKX1_RAT Sodium/potassium/calcium exchanger 1 (N... 29 3.9 sp|P21951|DPOE_YEAST DNA polymerase epsilon, catalytic subu... 28 8.6 sp|Q9DAK2|PACRG_MOUSE Parkin coregulated gene protein homol... 28 8.6
>sp|Q9QZM6|NCKX1_RAT Sodium/potassium/calcium exchanger 1 (Na(+)/K(+)/Ca(2+)-exchange protein 1) (Retinal rod Na-Ca+K exchanger) Length = 1181 Score = 28.9 bits (63), Expect = 3.9 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 78 NPNLQSSVRPINVGNNFSSAPPGVKRQPSSIEDW*TRLP 194 NP + + + P ++ NN+S G +RQ +I +R P Sbjct: 113 NPPITTKITPTSLKNNYSPTTAGTRRQKENIPPTPSRAP 151
>sp|P21951|DPOE_YEAST DNA polymerase epsilon, catalytic subunit A (DNA polymerase II subunit A) Length = 2222 Score = 27.7 bits (60), Expect = 8.6 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 5/50 (10%) Frame = +1 Query: 136 LLPVLRGSH-----PVLKIGKLVCHKEIKAFNLILNFVKLACVLIIVFIL 270 ++PVL GSH P+L++ K +CH + + + IL L L+ +F L Sbjct: 2036 VIPVLPGSHLNVKNPLLELVKSLCHVMLLSKSTILEIRTLRKELLKIFEL 2085
>sp|Q9DAK2|PACRG_MOUSE Parkin coregulated gene protein homolog (Hypertension related protein 1-like protein) Length = 241 Score = 27.7 bits (60), Expect = 8.6 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +1 Query: 55 RQLLAVTAIPICNHLLGPSM*EIISQALLPVLRGSHPVLKIGK 183 RQ++ VT + + HL+ S E++ +ALLP R P+L I K Sbjct: 146 RQIICVT-LKVLQHLVVSS--EMVGEALLPYYRQILPILNIFK 185
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,109,473 Number of Sequences: 369166 Number of extensions: 588943 Number of successful extensions: 1711 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1711 length of database: 68,354,980 effective HSP length: 61 effective length of database: 57,086,145 effective search space used: 1712584350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)