Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01329 (780 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P57528|EX5C_BUCAI Exodeoxyribonuclease V gamma chain 33 0.67 sp|O25300|LEP_HELPY Signal peptidase I (SPase I) (Leader pe... 30 9.7
>sp|P57528|EX5C_BUCAI Exodeoxyribonuclease V gamma chain Length = 1070 Score = 33.5 bits (75), Expect = 0.67 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 139 YKNIYKNYRISDTDKNRIINCYQNGENKELVSRFLN 32 Y+ IY Y I + KN++INC++ +NK L+S+ N Sbjct: 273 YEEIYYFY-ILKSKKNKVINCFKKNKNKSLLSQIKN 307
>sp|O25300|LEP_HELPY Signal peptidase I (SPase I) (Leader peptidase I) Length = 290 Score = 29.6 bits (65), Expect = 9.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -3 Query: 109 SDTDKNRIINCYQNGENKELVSRFLNINP 23 SDTDKN I Y N KE + + +NP Sbjct: 130 SDTDKNYIAKHYPNAMTKEFMGKIFVLNP 158
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,605,442 Number of Sequences: 369166 Number of extensions: 1371050 Number of successful extensions: 2985 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2984 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 7308943600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)