Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01224 (391 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P08547|LIN1_HUMAN LINE-1 reverse transcriptase homolog 28 4.9 sp|Q7NAQ9|TRUA_MYCGA tRNA pseudouridine synthase A (tRNA-ur... 28 8.4
>sp|P08547|LIN1_HUMAN LINE-1 reverse transcriptase homolog Length = 1259 Score = 28.5 bits (62), Expect = 4.9 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = +1 Query: 73 HLYNFIKF--LEIFNRW*RNRVWLKWCWFN 156 H+YN++ F E +W ++ ++ KWCW N Sbjct: 909 HIYNYLIFDKPEKNKQWGKDSLFNKWCWEN 938
>sp|Q7NAQ9|TRUA_MYCGA tRNA pseudouridine synthase A (tRNA-uridine isomerase I) (tRNA pseudouridylate synthase I) Length = 262 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 46 NEILLIYYDHLYNFIKFLEIFNRW*RNRVWLKW 144 N+ + Y D + K EI NR+ +N+ ++KW Sbjct: 79 NQYISFYIDDRISLEKLREILNRYGQNKWYIKW 111
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,580,757 Number of Sequences: 369166 Number of extensions: 406754 Number of successful extensions: 741 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 741 length of database: 68,354,980 effective HSP length: 96 effective length of database: 50,620,420 effective search space used: 1670473860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)