DrC_01018
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_01018 (397 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9VEW2|SERFL_DROME Putative SERF-like protein 41 0.001 sp|P84101|SERF2_HUMAN Small EDRK-rich factor 2 (4F5rel) (h4... 39 0.004 sp|O88892|SERF1_MOUSE Small EDRK-rich factor 1 (4F5) (m4F5) 33 0.21 sp|O75920|SERF1_HUMAN Small EDRK-rich factor 1a 30 1.3 sp|P47652|Y412_MYCGE Hypothetical lipoprotein MG412 precursor 30 1.3 sp|P51762|RCEL_CHRVI Reaction center protein L chain (Photo... 28 6.6
>sp|Q9VEW2|SERFL_DROME Putative SERF-like protein Length = 60 Score = 40.8 bits (94), Expect = 0.001 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +3 Query: 45 TGGNQRDLAREKNLKKQTKGVSSKETASNKGLTLEERRLRD 167 T GNQRDLAR+KN KKQ K T LT+E+R+ RD Sbjct: 2 TRGNQRDLARQKNQKKQADLTKGKRT---DNLTVEQRKARD 39
>sp|P84101|SERF2_HUMAN Small EDRK-rich factor 2 (4F5rel) (h4F5rel) (Gastric cancer-related protein VRG107) sp|P84102|SERF2_MOUSE Small EDRK-rich factor 2 (4F5rel) Length = 59 Score = 38.9 bits (89), Expect = 0.004 Identities = 20/41 (48%), Positives = 27/41 (65%) Frame = +3 Query: 45 TGGNQRDLAREKNLKKQTKGVSSKETASNKGLTLEERRLRD 167 T GNQR+LAR+KN+KKQ+ V K + GL+ R+ RD Sbjct: 2 TRGNQRELARQKNMKKQSDSVKGKR--RDDGLSAAARKQRD 40
>sp|O88892|SERF1_MOUSE Small EDRK-rich factor 1 (4F5) (m4F5) Length = 62 Score = 33.1 bits (74), Expect = 0.21 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +3 Query: 51 GNQRDLAREKNLKKQTKGVSSKETASNKGLTLEERRLRD 167 GNQR++AR+KN+KK + SK LT +R+ RD Sbjct: 4 GNQREIARQKNMKKTQE--ISKGKRKEDSLTASQRKQRD 40
>sp|O75920|SERF1_HUMAN Small EDRK-rich factor 1a Length = 110 Score = 30.4 bits (67), Expect = 1.3 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +3 Query: 51 GNQRDLAREKNLKKQTKGVSSKETASNKGLTLEERR 158 GNQR+LAR+KN+KK + SK LT +R+ Sbjct: 4 GNQRELARQKNMKKTQE--ISKGKRKEDSLTASQRK 37
>sp|P47652|Y412_MYCGE Hypothetical lipoprotein MG412 precursor Length = 377 Score = 30.4 bits (67), Expect = 1.3 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = -1 Query: 238 HFFTCSLLSVAFFFASCFALRACASLNLL----SSRVKPLLDAVS 116 +FF +LL++A S F L CA++NL+ SS V+PLL+ +S Sbjct: 6 NFFKLTLLTLA----SAFFLSGCANINLISAVGSSSVQPLLNKLS 46
>sp|P51762|RCEL_CHRVI Reaction center protein L chain (Photosynthetic reaction center L subunit) Length = 278 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 250 WMDYHFFTCSLLSVAFFFASCFALRACASLNL 155 ++ +H+ +L++ FFF +C AL SL L Sbjct: 170 FLHFHYNPAHMLAITFFFTNCLALSMHGSLIL 201
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 35,584,594
Number of Sequences: 369166
Number of extensions: 547504
Number of successful extensions: 1450
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1434
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1448
length of database: 68,354,980
effective HSP length: 97
effective length of database: 50,435,685
effective search space used: 1714813290
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
