Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_013_P03 (330 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P47652|Y412_MYCGE Hypothetical lipoprotein MG412 precursor 30 1.3 sp|Q03785|VHS1_YEAST Serine/threonine-protein kinase VHS1 (... 28 6.4 sp|P51762|RCEL_CHRVI Reaction center protein L chain (Photo... 28 6.4
>sp|P47652|Y412_MYCGE Hypothetical lipoprotein MG412 precursor Length = 377 Score = 30.4 bits (67), Expect = 1.3 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = -1 Query: 171 HFFTCSLLSVAFFFASCFALRACASLNLL----SSRVKPLLDAVS 49 +FF +LL++A S F L CA++NL+ SS V+PLL+ +S Sbjct: 6 NFFKLTLLTLA----SAFFLSGCANINLISAVGSSSVQPLLNKLS 46
>sp|Q03785|VHS1_YEAST Serine/threonine-protein kinase VHS1 (Viable in a HAL3 SIT4 background protein 1) Length = 461 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -1 Query: 171 HFFTCSLLSVAFFFASCFALRACASLNLLSSRVKPLLDAVSFEETPFVCFF 19 HF T LL F C AL C + +KP + E+ F+C F Sbjct: 154 HFVTNGLLVKKVFLQICSALNYCHEHGIYHCDIKPENLLLDTEDNVFLCDF 204
>sp|P51762|RCEL_CHRVI Reaction center protein L chain (Photosynthetic reaction center L subunit) Length = 278 Score = 28.1 bits (61), Expect = 6.4 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 183 WMDYHFFTCSLLSVAFFFASCFALRACASLNL 88 ++ +H+ +L++ FFF +C AL SL L Sbjct: 170 FLHFHYNPAHMLAITFFFTNCLALSMHGSLIL 201
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,830,976 Number of Sequences: 369166 Number of extensions: 452862 Number of successful extensions: 1195 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1195 length of database: 68,354,980 effective HSP length: 78 effective length of database: 53,945,650 effective search space used: 1672315150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)