DrC_00990
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00990 (733 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9V496|APLP_DROME Apolipophorins precursor (Retinoid- an... 32 1.7 sp|P69480|RRPP_RABVM Phosphoprotein (P protein) (M1) >gi|61... 31 3.0 sp|P16286|RRPP_RABVS Phosphoprotein (P protein) (M1) 31 3.0 sp|Q57766|FTR_METJA Formylmethanofuran--tetrahydromethanopt... 30 8.6
>sp|Q9V496|APLP_DROME Apolipophorins precursor (Retinoid- and fatty acid-binding glycoprotein) [Contains: Apolipophorin-2 (Apolipophorin II) (ApoL2); Apolipophorin-1 (Apolipophorin I) (ApoL1)] Length = 3351 Score = 32.0 bits (71), Expect = 1.7 Identities = 17/61 (27%), Positives = 32/61 (52%) Frame = +3 Query: 453 FDGAIEIKTNVHLQSPVIGVSPNISEYLKKLEIQEREKIKSEQGDNKSFLSKYWYYLLPI 632 F+ A E+ ++ Q ++ +P SE+L+KL K+K E DN+ ++ + L+ Sbjct: 2649 FEKATELTNSLFDQINILPQTPETSEFLQKLHDYLIAKLKQEHIDNEKYIEELGQLLIKA 2708 Query: 633 V 635 V Sbjct: 2709 V 2709
>sp|P69480|RRPP_RABVM Phosphoprotein (P protein) (M1) sp|P69479|RRPP_RABVE Phosphoprotein (P protein) (M1) Length = 297 Score = 31.2 bits (69), Expect = 3.0 Identities = 23/88 (26%), Positives = 40/88 (45%) Frame = +3 Query: 393 NIVGLYISTKEQQCNDEVIDFDGAIEIKTNVHLQSPVIGVSPNISEYLKKLEIQEREKIK 572 +++ I + E I+ D E +HL G SPN E K E + RE + Sbjct: 26 DLINRNIEDNQAHLQGEPIEVDNLPEDMGRLHLDD---GKSPNPGEMAKVGEGKYREDFQ 82 Query: 573 SEQGDNKSFLSKYWYYLLPIVILLVMTS 656 ++G++ SFL + + + + I+ M S Sbjct: 83 MDEGEDPSFLFQSYLENVGVQIVRQMRS 110
>sp|P16286|RRPP_RABVS Phosphoprotein (P protein) (M1) Length = 297 Score = 31.2 bits (69), Expect = 3.0 Identities = 23/88 (26%), Positives = 40/88 (45%) Frame = +3 Query: 393 NIVGLYISTKEQQCNDEVIDFDGAIEIKTNVHLQSPVIGVSPNISEYLKKLEIQEREKIK 572 +++ I + E I+ D E +HL G SPN E K E + RE + Sbjct: 26 DLINRNIEDNQAHLQGEPIEVDNLPEDMGRLHLDD---GKSPNHGEIAKVGEGKYREDFQ 82 Query: 573 SEQGDNKSFLSKYWYYLLPIVILLVMTS 656 ++G++ SFL + + + + I+ M S Sbjct: 83 MDEGEDPSFLFQSYLENVGVQIVRQMRS 110
>sp|Q57766|FTR_METJA Formylmethanofuran--tetrahydromethanopterin formyltransferase (H4MPT formyltransferase) Length = 301 Score = 29.6 bits (65), Expect = 8.6 Identities = 13/48 (27%), Positives = 29/48 (60%) Frame = +3 Query: 267 NGYYKIRISGLNSQFIETSIKTCQLIASKLKVDLQVSVDGFGNIVGLY 410 NG Y+I I G++ + ++ ++K L A+++K +++ +G +G Y Sbjct: 245 NGVYEIVIDGVDEESVKEAMKQGILAATRVKGVKKITAGNYGGKLGKY 292
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 72,481,547
Number of Sequences: 369166
Number of extensions: 1290534
Number of successful extensions: 3119
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 3039
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3119
length of database: 68,354,980
effective HSP length: 108
effective length of database: 48,403,600
effective search space used: 6534486000
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
