DrC_00969
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00969 (620 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q925B0|PAWR_MOUSE PRKC apoptosis WT1 regulator protein (... 31 2.2 sp|Q6L8H2|KRA53_HUMAN Keratin-associated protein 5-3 (Kerat... 31 2.9 sp|P14586|HRP3_PLAFS Histidine-rich protein 30 3.8 sp|Q62627|PAWR_RAT PRKC apoptosis WT1 regulator protein (Pr... 30 3.8 sp|Q8FWU0|CATA_BRUSU Catalase 30 4.9 sp|Q9GKS9|CT012_MACFA Protein C20orf12 homolog 30 6.4 sp|Q23985|DTX_DROME Deltex protein 29 8.4 sp|Q9NVP4|CT012_HUMAN Protein C20orf12 29 8.4
>sp|Q925B0|PAWR_MOUSE PRKC apoptosis WT1 regulator protein (Prostate apoptosis response-4 protein) (Par-4) Length = 197 Score = 31.2 bits (69), Expect = 2.2 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 376 QQPYGKNNAITKHITIAKQPGVVVYRGTTVLPQPPQNLVPGK 251 Q+ + +AIT+ TI + + GT+ LPQ P VPG+ Sbjct: 41 QKERKREDAITQQNTIQNEAATLPDPGTSYLPQDPSRTVPGR 82
>sp|Q6L8H2|KRA53_HUMAN Keratin-associated protein 5-3 (Keratin-associated protein 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 30.8 bits (68), Expect = 2.9 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 4/60 (6%) Frame = +3 Query: 270 CGGCGSTVVPRYTTTPGCFAIVMCLVIALFLPYGCCLIPFCA----AGCQDVHRICPTCG 437 CGGCGS+ + GC C+ + P CC +P C+ C +C +CG Sbjct: 14 CGGCGSSCGGCGSGYGGC-GSGCCVPVCCCKPV-CCCVPACSCSSCGSCGGSKGVCGSCG 71
>sp|P14586|HRP3_PLAFS Histidine-rich protein Length = 82 Score = 30.4 bits (67), Expect = 3.8 Identities = 23/84 (27%), Positives = 39/84 (46%) Frame = +1 Query: 55 IRHRVMCHSHKYK*FNHNQYKCINHHHQYR*FNHNQYK*FNHHQYQYYNLRLLQAKIQPL 234 + HR + H++ NH+ Y HH +R +H +HH++Q L + +I + Sbjct: 2 LNHRYHHYFHRHHHLNHHLYH---RHHHHRHHHHR-----HHHRHQI--LHQNRHQIHQI 51 Query: 235 *LEINLYQELNSVEVVAVLLFLDI 306 L +N N + A+ LFL I Sbjct: 52 LLSLN-----NKIMGYAIFLFLSI 70
>sp|Q62627|PAWR_RAT PRKC apoptosis WT1 regulator protein (Prostate apoptosis response-4 protein) (Par-4) (Transcriptional repressor Par-4-like protein PAWR) Length = 332 Score = 30.4 bits (67), Expect = 3.8 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 376 QQPYGKNNAITKHITIAKQPGVVVYRGTTVLPQPPQNLVPGK 251 Q+ + +AIT+ TI + + GT+ LPQ P VPG+ Sbjct: 176 QKERKREDAITQQNTIQNEAASLPDPGTSYLPQDPSRTVPGR 217
>sp|Q8FWU0|CATA_BRUSU Catalase Length = 499 Score = 30.0 bits (66), Expect = 4.9 Identities = 16/39 (41%), Positives = 22/39 (56%) Frame = +1 Query: 19 LLQPR*FAYKKQIRHRVMCHSHKYK*FNHNQYKCINHHH 135 +LQ R F+Y RHR+ H Y+ NQ KC+ HH+ Sbjct: 329 MLQARIFSYADAHRHRLGTH---YESIPVNQPKCLVHHY 364
>sp|Q9GKS9|CT012_MACFA Protein C20orf12 homolog Length = 606 Score = 29.6 bits (65), Expect = 6.4 Identities = 23/88 (26%), Positives = 36/88 (40%), Gaps = 6/88 (6%) Frame = +3 Query: 216 SQNTTIVVGNQSLP------GTKFCGGCGSTVVPRYTTTPGCFAIVMCLVIALFLPYGCC 377 S +I G+++ P GT C CG + + C A+ L +P GC Sbjct: 163 SSQESICSGDKASPPPTQKGGTISCSRCGRWNLWEASFCGWCGAM-------LGIPAGCS 215 Query: 378 LIPFCAAGCQDVHRICPTCGRTLEVITK 461 + P C A R C +CG ++ + K Sbjct: 216 VCPKCGASNHLSARFCGSCGICVKSLVK 243
>sp|Q23985|DTX_DROME Deltex protein Length = 738 Score = 29.3 bits (64), Expect = 8.4 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +1 Query: 61 HRVMCHSHKYK*FNHNQYKCINHHHQYR*FNHNQYK*FNHHQYQYYNLRLLQAKIQP 231 H+V H+++ H Q + HHHQ++ H Q + HQ Q++ + A +P Sbjct: 259 HQVQQQQHQHQ---HQQQQQQQHHHQHQQQQHQQQQ---QHQMQHHQIHHQTAPRKP 309
>sp|Q9NVP4|CT012_HUMAN Protein C20orf12 Length = 579 Score = 29.3 bits (64), Expect = 8.4 Identities = 19/74 (25%), Positives = 27/74 (36%) Frame = +3 Query: 240 GNQSLPGTKFCGGCGSTVVPRYTTTPGCFAIVMCLVIALFLPYGCCLIPFCAAGCQDVHR 419 G +L FCG CG+ L +P GC + P C A R Sbjct: 170 GRWNLWEASFCGWCGAM---------------------LGIPAGCSVCPKCGASNHLSAR 208 Query: 420 ICPTCGRTLEVITK 461 C +CG ++ + K Sbjct: 209 FCGSCGICVKSLVK 222
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 58,240,334
Number of Sequences: 369166
Number of extensions: 1058122
Number of successful extensions: 3059
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 2823
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2986
length of database: 68,354,980
effective HSP length: 106
effective length of database: 48,773,070
effective search space used: 4877307000
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
