DrC_00865
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00865 (511 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P12996|BIOB_ECOLI Biotin synthase (Biotin synthetase) 31 1.9 sp|P36569|BIOB_SERMA Biotin synthase (Biotin synthetase) 31 1.9 sp|Q47862|BIOB_ENTAG Biotin synthase (Biotin synthetase) 30 2.5 sp|P12678|BIOB_SALTY Biotin synthase (Biotin synthetase) 30 3.3 sp|Q9FVT2|EF1H_ARATH Probable elongation factor 1-gamma 2 (... 29 5.6
>sp|P12996|BIOB_ECOLI Biotin synthase (Biotin synthetase) Length = 346 Score = 30.8 bits (68), Expect = 1.9 Identities = 13/49 (26%), Positives = 29/49 (59%) Frame = -1 Query: 424 KQINKQLEAVCVYIEEIPIFNKCTIIIIYH*KKDKNMMNYKQLNYNQEQ 278 +Q+N+Q +A+C IF C ++ + ++DK++ +++L N +Q Sbjct: 266 EQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQ 314
>sp|P36569|BIOB_SERMA Biotin synthase (Biotin synthetase) Length = 346 Score = 30.8 bits (68), Expect = 1.9 Identities = 13/49 (26%), Positives = 29/49 (59%) Frame = -1 Query: 424 KQINKQLEAVCVYIEEIPIFNKCTIIIIYH*KKDKNMMNYKQLNYNQEQ 278 +Q+N+Q +A+C IF C ++ + ++DK++ +++L N +Q Sbjct: 267 EQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDLQLFRKLGLNPQQ 315
>sp|Q47862|BIOB_ENTAG Biotin synthase (Biotin synthetase) Length = 346 Score = 30.4 bits (67), Expect = 2.5 Identities = 13/49 (26%), Positives = 29/49 (59%) Frame = -1 Query: 424 KQINKQLEAVCVYIEEIPIFNKCTIIIIYH*KKDKNMMNYKQLNYNQEQ 278 +Q+N+Q +A+C IF C ++ + ++DK++ +++L N +Q Sbjct: 266 EQMNEQTQAMCFMAGANSIFYGCKLLTTPNPEEDKDVQLFRKLGLNPQQ 314
>sp|P12678|BIOB_SALTY Biotin synthase (Biotin synthetase) Length = 346 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/49 (26%), Positives = 28/49 (57%) Frame = -1 Query: 424 KQINKQLEAVCVYIEEIPIFNKCTIIIIYH*KKDKNMMNYKQLNYNQEQ 278 +Q+N+Q +A+C IF C ++ + +DK++ +++L N +Q Sbjct: 266 EQMNEQTQAMCFMAGANSIFYGCKLLTTPNPAEDKDLQLFRKLGLNPQQ 314
>sp|Q9FVT2|EF1H_ARATH Probable elongation factor 1-gamma 2 (EF-1-gamma) (eEF-1B gamma) Length = 413 Score = 29.3 bits (64), Expect = 5.6 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 354 VHLLKIGISSM*THTASNCLLICLGSCVCACDWLNAYEMNLGF 482 + LK G+ ++ TH ASN L+ G V D + +NLGF Sbjct: 131 ISALKRGLEALNTHLASNTFLV--GHSVTLADIVTICNLNLGF 171
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 54,583,638
Number of Sequences: 369166
Number of extensions: 945042
Number of successful extensions: 1820
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1750
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1815
length of database: 68,354,980
effective HSP length: 103
effective length of database: 49,327,275
effective search space used: 3255600150
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
