Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00851 (401 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P53707|CS37_CANAL 37 kDa cell surface protein 29 3.0 sp|P34106|ALA2_PANMI Alanine aminotransferase 2 (GPT) (Glut... 28 8.8 sp|Q6EVY7|YCF2_NYMAL Protein ycf2 28 8.8
>sp|P53707|CS37_CANAL 37 kDa cell surface protein Length = 321 Score = 29.3 bits (64), Expect = 3.0 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 197 NW*KTRINRKKA-WF-NWQTTWFDWKKAWNDWEKAWNDRETKCN 322 NW +I+ A W +++ DW KA +D K WND + + N Sbjct: 204 NWTNKQIDYASAEWHKHYEQAKGDWNKALDDLSKQWNDSKKQLN 247
>sp|P34106|ALA2_PANMI Alanine aminotransferase 2 (GPT) (Glutamic--pyruvic transaminase 2) (Glutamic--alanine transaminase 2) (ALAAT-2) Length = 482 Score = 27.7 bits (60), Expect = 8.8 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 27 VLADLNSDCDICKICEAEGLMSSAECCLDNSFYDACEDRMENSF 158 VLA+ N CDI + C+ EGL+ A+ + Y +D+ NSF Sbjct: 235 VLAEDNQ-CDIVRFCKNEGLVLLADEVYQENIY--VDDKKFNSF 275
>sp|Q6EVY7|YCF2_NYMAL Protein ycf2 Length = 2253 Score = 27.7 bits (60), Expect = 8.8 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 7/31 (22%) Frame = -1 Query: 335 LFITHYISFPYHSTP-------FPNHSTPFS 264 +F+ HY + Y TP FP+H PFS Sbjct: 1555 IFLAHYQTITYSQTPCGANSSHFPSHGKPFS 1585
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 36,819,845
Number of Sequences: 369166
Number of extensions: 595062
Number of successful extensions: 1715
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1636
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1707
length of database: 68,354,980
effective HSP length: 98
effective length of database: 50,250,950
effective search space used: 1758783250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)