Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00828 (536 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P10845|BXA1_CLOBO Botulinum neurotoxin type A precursor ... 33 0.34 sp|Q45894|BXA2_CLOBO Botulinum neurotoxin type A precursor ... 30 3.7
>sp|P10845|BXA1_CLOBO Botulinum neurotoxin type A precursor (BoNT/A) (Bontoxilysin A) (BOTOX) [Contains: Botulinum neurotoxin A light-chain; Botulinum neurotoxin A heavy-chain] Length = 1296 Score = 33.5 bits (75), Expect = 0.34 Identities = 25/72 (34%), Positives = 43/72 (59%), Gaps = 7/72 (9%) Frame = -3 Query: 399 NLKLNFIK---SGRSMDECGLTALSSI---SNIGY-LDGLQDSQKII*KFTYNLADSSLS 241 N +LN K +GR +D+ ++ L +I +NI + LDG +D+ + I +NL D L+ Sbjct: 1021 NNRLNNSKIYINGRLIDQKPISNLGNIHASNNIMFKLDGCRDTHRYIWIKYFNLFDKELN 1080 Query: 240 DKDLKFLYSHVS 205 +K++K LY + S Sbjct: 1081 EKEIKDLYDNQS 1092
>sp|Q45894|BXA2_CLOBO Botulinum neurotoxin type A precursor (BoNT/A) (Bontoxilysin A) (BOTOX) [Contains: Botulinum neurotoxin A light-chain; Botulinum neurotoxin A heavy-chain] Length = 1296 Score = 30.0 bits (66), Expect = 3.7 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = -3 Query: 375 SGRSMDECGLTALSSI--SN--IGYLDGLQDSQKII*KFTYNLADSSLSDKDLKFLYSHV 208 +GR +D+ ++ L +I SN + LDG +D ++ I +NL D L++K++K LY Sbjct: 1032 NGRLIDQKPISNLGNIHASNKIMFKLDGCRDPRRYIMIKYFNLFDKELNEKEIKDLYDSQ 1091 Query: 207 S 205 S Sbjct: 1092 S 1092
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,404,217 Number of Sequences: 369166 Number of extensions: 899213 Number of successful extensions: 1560 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1559 length of database: 68,354,980 effective HSP length: 103 effective length of database: 49,327,275 effective search space used: 3699545625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)