Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00816 (761 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P04929|HRPX_PLALO Histidine-rich glycoprotein precursor 40 0.009 sp|P36417|GBF_DICDI G-box binding factor (GBF) 37 0.058 sp|Q01306|CCG8_NEUCR Clock-controlled protein 8 35 0.29 sp|P14586|HRP3_PLAFS Histidine-rich protein 33 0.84 sp|P23792|DISC_DROME Disconnected protein 32 1.4 sp|Q24432|OMB_DROME Optomotor-blind protein (Lethal(1)optom... 32 1.4 sp|Q9V7N5|VATC_DROME Vacuolar ATP synthase subunit C (V-ATP... 32 2.4 sp|Q9NYV4|CD2L7_HUMAN Cell division cycle 2-related protein... 32 2.4 sp|Q23985|DTX_DROME Deltex protein 30 7.1 sp|P26675|SOS_DROME Son of sevenless protein 30 9.3
>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein precursor Length = 351 Score = 39.7 bits (91), Expect = 0.009 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H +HH HH P+ +H G HH + Sbjct: 178 HHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHGHHHHH 228
Score = 38.9 bits (89), Expect = 0.015 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 Y HH HH + H + H +HH HH P+ +H HH + Sbjct: 168 YHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHH 218
Score = 36.2 bits (82), Expect = 0.099 Identities = 16/51 (31%), Positives = 21/51 (41%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 +FHH HHL H H +HH HH P+ +H HH + Sbjct: 160 WFHH---HHLGYH---------HHHAPHHHHHHHHAPHHHHHHHHAPHHHH 198
Score = 35.0 bits (79), Expect = 0.22 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H +HH HH + +H G HH + Sbjct: 188 HHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHGHHHHHHHHHGHHHHH 238
Score = 34.7 bits (78), Expect = 0.29 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H L +H HH P+ +H HH + Sbjct: 141 HHHHHEEHHHHHHAAHHHPWFHHHHL---GYHHHHAPHHHHHHHHAPHHHH 188
Score = 34.3 bits (77), Expect = 0.38 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H +HH HH + +H G HH + Sbjct: 198 HHHHHAPHHHHHHHHAPHHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHHH 248
Score = 33.9 bits (76), Expect = 0.49 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HHL HH + H ++ H HH HH + +H HH + Sbjct: 111 HHHHLGHHHHHHHAAHHHHHEEHHHHHHAAHHHHHEEH-HHHHHAAHHHPW 160
Score = 33.5 bits (75), Expect = 0.64 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H D +HH H + +H HH + Sbjct: 229 HHHHGHHHHHHHHHGHHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHH 279
Score = 33.5 bits (75), Expect = 0.64 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H D +HH H + +H HH + Sbjct: 288 HHHHHDAHHHHHHHHDAHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHH 338
Score = 33.5 bits (75), Expect = 0.64 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H D +HH H + +H HH + Sbjct: 298 HHHHHDAHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHH 348
Score = 33.1 bits (74), Expect = 0.84 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = -2 Query: 445 HHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 HH HH + + ++ H HH HH P +H G HH + Sbjct: 73 HHEEHHHHHPEEHHEPHHEEHHHHHPHPHHHHHHHPPHHHHHLGHHHHH 121
Score = 33.1 bits (74), Expect = 0.84 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H D +HH H + +H HH + Sbjct: 239 HHHHGHHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHH 289
Score = 32.7 bits (73), Expect = 1.1 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H D +HH H + +H HH + Sbjct: 249 HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHH 299
Score = 32.7 bits (73), Expect = 1.1 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H D +HH H + +H HH + Sbjct: 259 HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHH 309
Score = 32.0 bits (71), Expect = 1.9 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H D +HH HH + +H HH + Sbjct: 269 HHHHDAHHHHHHHHDAHHHHHHHHDAH-HHHHHHHDAHHHHHHHDAHHHHH 318
Score = 31.6 bits (70), Expect = 2.4 Identities = 14/51 (27%), Positives = 21/51 (41%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H D +HH HH + +H HH + Sbjct: 279 HHHHDAHHHHHHHHDAHHHHHHHHDAH--HHHHHHDAHHHHHHHHDAHHHH 327
Score = 31.2 bits (69), Expect = 3.2 Identities = 14/49 (28%), Positives = 18/49 (36%) Frame = -2 Query: 445 HHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 HH HH + H H HH HHL + +H HH + Sbjct: 89 HHEEHHHHHPH-------PHHHHHHHPPHHHHHLGHHHHHHHAAHHHHH 130
Score = 31.2 bits (69), Expect = 3.2 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H L +HH HH + +H +HH + Sbjct: 94 HHHHPHPHHHHHH------HPPHHHHHLGHHHHHH--HAAHHHHHEEHHHH 136
Score = 30.8 bits (68), Expect = 4.2 Identities = 13/51 (25%), Positives = 20/51 (39%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H +HH HH + +H HH + Sbjct: 218 HHHHHGHHHHHHHHHGHHHHHHHHHGHHHHHHHHHDAHHHHHHHHDAHHHH 268
Score = 30.0 bits (66), Expect = 7.1 Identities = 12/51 (23%), Positives = 19/51 (37%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 + HH HH + H + H +HH H + +H HH + Sbjct: 219 HHHHGHHHHHHHHHGHHHHHHHHHGHHHHHHHHHDAHHHHHHHHDAHHHHH 269
>sp|P36417|GBF_DICDI G-box binding factor (GBF) Length = 708 Score = 37.0 bits (84), Expect = 0.058 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%) Frame = -2 Query: 445 HHLRIHHLNQHCLRKILYQSHQDLQ---LTNHHRHHLPYPRRQNHQGQHHQ 302 HH ++ QH + Q HQ +Q L H H ++Q HQ QHHQ Sbjct: 158 HHQQMQQQQQHHQQMQQQQHHQQMQHHQLQQHQHQHQQQQQQQQHQQQHHQ 208
Score = 32.0 bits (71), Expect = 1.9 Identities = 16/48 (33%), Positives = 22/48 (45%) Frame = -2 Query: 442 HLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQY 299 H + HH Q Q Q Q HH+H P + Q++Q Q HQ+ Sbjct: 202 HQQQHHQQQQ------QQQQQHHQQQQHHQHSQPQQQHQHNQQQQHQH 243
>sp|Q01306|CCG8_NEUCR Clock-controlled protein 8 Length = 661 Score = 34.7 bits (78), Expect = 0.29 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -2 Query: 445 HHLRIHHLNQHCLRKILYQSHQDLQLT-NHHRHHLPYPRRQNHQGQHHQ 302 HH H++ ++ +Q HQ Q HH+H+ +Q HQ HHQ Sbjct: 3 HHHHHRHMHSPSSQQHEHQQHQQYQQPPQHHQHYEAPQHQQQHQHHHHQ 51
>sp|P14586|HRP3_PLAFS Histidine-rich protein Length = 82 Score = 33.1 bits (74), Expect = 0.84 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHHQ 302 YFH R HHLN H + + H +HHRHH + ++ Q HQ Sbjct: 9 YFH--RHHHLNHHLYHRHHHHRH------HHHRHHHRHQILHQNRHQIHQ 50
>sp|P23792|DISC_DROME Disconnected protein Length = 568 Score = 32.3 bits (72), Expect = 1.4 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHR---HHLPYPRRQNHQGQHHQY 299 Y HH ++ +Q + H L L++HH+ HHL + +H HHQ+ Sbjct: 503 YNHHHQLQQQHQQ-------EQHHHLTLSHHHQEQHHHLGHHHMGHHHHHHHQH 549
>sp|Q24432|OMB_DROME Optomotor-blind protein (Lethal(1)optomotor-blind) (L(1)omb) (Bifid protein) Length = 972 Score = 32.3 bits (72), Expect = 1.4 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNHQGQHH 305 + HH + HH Q +QSH Q +H + P+P Q H HH Sbjct: 923 HHHHTQAHHQQQQ------HQSHHQQQ--HHQQPAQPHPHHQTHLHSHH 963
>sp|Q9V7N5|VATC_DROME Vacuolar ATP synthase subunit C (V-ATPase C subunit) (Vacuolar proton pump C subunit) Length = 714 Score = 31.6 bits (70), Expect = 2.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 445 HHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHH 347 HH RI HL+ RK + HQ+ HH HH Sbjct: 109 HHQRIKHLSLRHQRKHQHTHHQNKPQHYHHHHH 141
>sp|Q9NYV4|CD2L7_HUMAN Cell division cycle 2-related protein kinase 7 (CDC2-related protein kinase 7) (CrkRS) Length = 1490 Score = 31.6 bits (70), Expect = 2.4 Identities = 24/52 (46%), Positives = 28/52 (53%) Frame = +3 Query: 504 KERTCKSS*KERTCKSS*KERTCKSSRKERTCKSS*KERTYKSSRKERTCKS 659 K + KSS KE KE+T RKER KS K+R+ KS RK T KS Sbjct: 163 KAQVAKSSSKESRSSKLHKEKT----RKERELKSGHKDRS-KSHRKRETPKS 209
>sp|Q23985|DTX_DROME Deltex protein Length = 738 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = -2 Query: 394 YQSHQDLQLTNHHRHHLP-YPRRQNHQGQHHQ 302 +Q Q Q +HH+H + ++Q HQ QHHQ Sbjct: 268 HQHQQQQQQQHHHQHQQQQHQQQQQHQMQHHQ 299
>sp|P26675|SOS_DROME Son of sevenless protein Length = 1596 Score = 29.6 bits (65), Expect = 9.3 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = -2 Query: 451 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHHRHHLPYPRRQNH 320 Y H LR+ Q +Y H HH HLP+ Q+H Sbjct: 1504 YAHQLRMRQQQQQQTHPAIYSQHHQ-----HHATHLPHHPHQHH 1542
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.302 0.118 0.310 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,217,248 Number of Sequences: 369166 Number of extensions: 369408 Number of successful extensions: 1345 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1212 length of database: 68,354,980 effective HSP length: 108 effective length of database: 48,403,600 effective search space used: 7018522000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 17 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.8 bits)