Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_005_D18 (691 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isofor... 37 0.064 sp|P04929|HRPX_PLALO Histidine-rich glycoprotein precursor 37 0.064 sp|P14586|HRP3_PLAFS Histidine-rich protein 33 0.71 sp|P36417|GBF_DICDI G-box binding factor (GBF) 33 0.71 sp|Q01306|CCG8_NEUCR Clock-controlled protein 8 32 2.1 sp|Q9V7N5|VATC_DROME Vacuolar ATP synthase subunit C (V-ATP... 32 2.1 sp|Q62563|SRY_MUSSP Sex-determining region Y protein (Testi... 31 2.7 sp|Q01371|WC1_NEUCR White collar 1 protein (WC1) 30 4.6 sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 (D... 30 4.6 sp|P10627|TWIST_DROME Twist protein 30 6.0
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/R/T Length = 970 Score = 36.6 bits (83), Expect = 0.064 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -2 Query: 387 HHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHH 265 HH+ QH ++ +Q H T H +P +Q+HQ QHH Sbjct: 598 HHIIQHVSQEPHHQEHHQQHQTIHIEEVPQTSQQHHQQQHH 638
>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein precursor Length = 351 Score = 36.6 bits (83), Expect = 0.064 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H +H HH P+ +H G HH + Sbjct: 179 HHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHGHHHHH 228
Score = 33.9 bits (76), Expect = 0.42 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H +H HH P+ +H HH + Sbjct: 169 HHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHAPHHHH 218
Score = 33.1 bits (74), Expect = 0.71 Identities = 13/50 (26%), Positives = 19/50 (38%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HHL HH + H ++ H H HH +H HH + Sbjct: 111 HHHHLGHHHHHHHAAHHHHHEEHHHHHHAAHHHHHEEHHHHHHAAHHHPW 160
Score = 33.1 bits (74), Expect = 0.71 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H L H HH P+ +H HH + Sbjct: 141 HHHHHEEHHHHHHAAHHHPWFHHH--HLGYHHHHAPHHHHHHHHAPHHHH 188
Score = 32.3 bits (72), Expect = 1.2 Identities = 15/50 (30%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 +FHH HHL H H +H HH P+ +H HH + Sbjct: 160 WFHH---HHLGYH--------HHHAPHHHHHHHHAPHHHHHHHHAPHHHH 198
Score = 32.3 bits (72), Expect = 1.2 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 Y HH HH + H H +H HH P+ +H HH + Sbjct: 168 YHHHHAPHHHHHH---------HHAPHHHHHHHHAPHHHHHHHHAPHHHH 208
Score = 32.3 bits (72), Expect = 1.2 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H +H HH + +H G HH + Sbjct: 199 HHHHAPHHHHHHHHAPHHHHHHHHGHHHHHHHHHGHHHHHHHHHGHHHHH 248
Score = 32.3 bits (72), Expect = 1.2 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H D +H HH + +H HH + Sbjct: 229 HHHHGHHHHHHHHHGHHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHH 278
Score = 32.3 bits (72), Expect = 1.2 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H D +H HH + +H HH + Sbjct: 269 HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHDAHHHHH 318
Score = 32.3 bits (72), Expect = 1.2 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H D +H HH + +H HH + Sbjct: 288 HHHHHDAHHHHHHHHDAHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHH 337
Score = 32.3 bits (72), Expect = 1.2 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H D +H HH + +H HH + Sbjct: 298 HHHHHDAHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHH 347
Score = 32.0 bits (71), Expect = 1.6 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H +H HH + +H G HH + Sbjct: 189 HHHHAPHHHHHHHHAPHHHHHHHHAPHHHHHHHHGHHHHHHHHHGHHHHH 238
Score = 32.0 bits (71), Expect = 1.6 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H D +H HH + +H HH + Sbjct: 239 HHHHGHHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHH 288
Score = 31.6 bits (70), Expect = 2.1 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H D +H HH + +H HH + Sbjct: 249 HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHH 298
Score = 31.6 bits (70), Expect = 2.1 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H D +H HH + +H HH + Sbjct: 259 HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHHDAHHHH 308
Score = 30.0 bits (66), Expect = 6.0 Identities = 14/50 (28%), Positives = 19/50 (38%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH H + H +H HH P +H G HH + Sbjct: 78 HHHHPEEHHEPHH------EEHHHHHPHPHHHHHHHPPHHHHHLGHHHHH 121
Score = 30.0 bits (66), Expect = 6.0 Identities = 13/50 (26%), Positives = 20/50 (40%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H L +H HH +H+ HH + Sbjct: 94 HHHHPHPHHHHHH------HPPHHHHHLGHHHHHHHAAHHHHHEEHHHHH 137
Score = 29.6 bits (65), Expect = 7.8 Identities = 12/50 (24%), Positives = 19/50 (38%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 + HH HH + H + H D +H H + +H HH + Sbjct: 279 HHHHDAHHHHHHHHDAHHHHHHHHDAHHHHHHHDAHHHHHHHHDAHHHHH 328
>sp|P14586|HRP3_PLAFS Histidine-rich protein Length = 82 Score = 33.1 bits (74), Expect = 0.71 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = -2 Query: 408 YFHHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQ 262 YFH R HHLN H LY H + +HRHH + ++ Q HQ Sbjct: 9 YFH--RHHHLNHH-----LYHRHHHHRHHHHRHHHRHQILHQNRHQIHQ 50
>sp|P36417|GBF_DICDI G-box binding factor (GBF) Length = 708 Score = 33.1 bits (74), Expect = 0.71 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -2 Query: 402 HHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQ 262 HH ++ H + Q HQ +Q H + + + Q HQ QH Q Sbjct: 149 HHQQMQQQQHHQQMQQQQQHHQQMQQQQHHQQMQHHQLQQHQHQHQQ 195
Score = 30.8 bits (68), Expect = 3.5 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 5/52 (9%) Frame = -2 Query: 402 HHLRIHHLNQHCLRKILYQSHQD-----LQLTNHRHHLPYPRRQNHQGQHHQ 262 HH ++ QH + Q HQ LQ H+H ++Q HQ QHHQ Sbjct: 158 HHQQMQQQQQHHQQMQQQQHHQQMQHHQLQQHQHQHQ-QQQQQQQHQQQHHQ 208
Score = 29.6 bits (65), Expect = 7.8 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 402 HHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQ-GQHHQ 262 HH + QH + Q HQ +Q +HH ++Q+HQ QHHQ Sbjct: 139 HHQQQQQQPQHHQQMQQQQHHQQMQ-QQQQHHQQMQQQQHHQQMQHHQ 185
Score = 29.6 bits (65), Expect = 7.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -2 Query: 384 HLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 H QH ++ Q Q +H+H P + Q++Q Q HQ+ Sbjct: 202 HQQQHHQQQQQQQQQHHQQQQHHQHSQPQQQHQHNQQQQHQH 243
>sp|Q01306|CCG8_NEUCR Clock-controlled protein 8 Length = 661 Score = 31.6 bits (70), Expect = 2.1 Identities = 15/49 (30%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -2 Query: 402 HHLRIHHLNQHCLRKILYQSHQDLQLT--NHRHHLPYPRRQNHQGQHHQ 262 HH H++ ++ +Q HQ Q +H+H+ +Q HQ HHQ Sbjct: 3 HHHHHRHMHSPSSQQHEHQQHQQYQQPPQHHQHYEAPQHQQQHQHHHHQ 51
>sp|Q9V7N5|VATC_DROME Vacuolar ATP synthase subunit C (V-ATPase C subunit) (Vacuolar proton pump C subunit) Length = 714 Score = 31.6 bits (70), Expect = 2.1 Identities = 18/47 (38%), Positives = 21/47 (44%) Frame = -2 Query: 402 HHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQ 262 HH RI HL+ RK HQ H HH P+ +H HHQ Sbjct: 109 HHQRIKHLSLRHQRK-----HQ------HTHHQNKPQHYHHHHHHHQ 144
>sp|Q62563|SRY_MUSSP Sex-determining region Y protein (Testis-determining factor) Length = 355 Score = 31.2 bits (69), Expect = 2.7 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -2 Query: 402 HHLRIHHLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQ 262 H + + H +K + HQ Q H HH ++Q H HHQ Sbjct: 183 HQQQQQQFHDHQQQKQQFHDHQQQQQQFHDHHHQQQQQQFHDHHHHQ 229
>sp|Q01371|WC1_NEUCR White collar 1 protein (WC1) Length = 1167 Score = 30.4 bits (67), Expect = 4.6 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = -2 Query: 399 HLRIHHLNQHCLRKI-LYQSHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 HL+ HLN ++++ ++ HQ Q + + H ++Q+ Q Q HQ+ Sbjct: 1082 HLQGTHLNAQAMQRVHQHKQHQQHQQQHQQQHQQQHQQQHQQLQQHQF 1129
>sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 (DNedd4) Length = 1007 Score = 30.4 bits (67), Expect = 4.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 384 HLNQHCLRKILYQSHQDLQLTNHRHHLPYPRRQNHQGQH 268 H+ QH R+ Q ++ L +HR P R Q HQ QH Sbjct: 445 HIQQHQQRQQQQQQNRILLDVDHRQQEPQHRGQRHQQQH 483
>sp|P10627|TWIST_DROME Twist protein Length = 490 Score = 30.0 bits (66), Expect = 6.0 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 396 LRIHHLNQHCLRKILYQ-SHQDLQLTNHRHHLPYPRRQNHQGQHHQY 259 +++ + Q + YQ HQ L +H+HH +Q+HQ QH QY Sbjct: 32 IKLIQVEQQAYMQSGYQLQHQQQHLHSHQHH-----QQHHQQQHAQY 73
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,566,987 Number of Sequences: 369166 Number of extensions: 303521 Number of successful extensions: 1458 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1396 length of database: 68,354,980 effective HSP length: 107 effective length of database: 48,588,335 effective search space used: 5927776870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)