Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00671 (510 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7M2P1|STP3_PIG Spermatid nuclear transition protein 3 (... 29 7.3 sp|P32598|PP12_YEAST Serine/threonine protein phosphatase P... 28 9.6
>sp|Q7M2P1|STP3_PIG Spermatid nuclear transition protein 3 (STP-3) (TP-3) (TP3) Length = 76 Score = 28.9 bits (63), Expect = 7.3 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +2 Query: 128 TRQPWQPRSTYTPSWRPRPTRNYINNRLSRLERQIRIIYSRV 253 T + WQP++T T W+ R T + +R ++R IY +V Sbjct: 4 TEKSWQPQTTSTKRWKKRKTPSQPRSR-----GKVRKIYKKV 40
>sp|P32598|PP12_YEAST Serine/threonine protein phosphatase PP1-2 Length = 312 Score = 28.5 bits (62), Expect = 9.6 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 345 LRYLCNTLRK*FNKEPLFLLFKLFINRCNELTREY 241 +RYLC+ R F K+P+ L + I C ++ +Y Sbjct: 34 IRYLCSKARSIFIKQPILLELEAPIKICGDIHGQY 68
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,216,804
Number of Sequences: 369166
Number of extensions: 637913
Number of successful extensions: 1616
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1551
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1614
length of database: 68,354,980
effective HSP length: 103
effective length of database: 49,327,275
effective search space used: 3255600150
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)