Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dr_sW_012_J01 (488 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q7M2P1|STP3_PIG Spermatid nuclear transition protein 3 (... 29 6.7 sp|P32598|PP12_YEAST Serine/threonine protein phosphatase P... 28 8.8
>sp|Q7M2P1|STP3_PIG Spermatid nuclear transition protein 3 (STP-3) (TP-3) (TP3) Length = 76 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 109 TRQPWQPRSTYTPSWRPRPTRNYINNRLSRLERQIRIIYSRV 234 T + WQP++T T W+ R T + +R ++R IY +V Sbjct: 4 TEKSWQPQTTSTKRWKKRKTPSQPRSR-----GKVRKIYKKV 40
>sp|P32598|PP12_YEAST Serine/threonine protein phosphatase PP1-2 Length = 312 Score = 28.5 bits (62), Expect = 8.8 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 326 LRYLCNTLRK*FNKEPLFLLFKLFINRCNELTREY 222 +RYLC+ R F K+P+ L + I C ++ +Y Sbjct: 34 IRYLCSKARSIFIKQPILLELEAPIKICGDIHGQY 68
Database: Non-redundant SwissProt sequences Posted date: Dec 6, 2005 7:40 AM Number of letters in database: 68,354,980 Number of sequences in database: 184,735 Database: swissprot.01 Posted date: Dec 6, 2005 8:18 AM Number of letters in database: 66,202,850 Number of sequences in database: 184,431 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,307,629 Number of Sequences: 369166 Number of extensions: 604348 Number of successful extensions: 1595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1593 length of database: 68,354,980 effective HSP length: 102 effective length of database: 49,512,010 effective search space used: 2970720600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)