DrC_00664
- Cluster detail
- GO Category : Not Available
- Consensus Sequence :
BLASTX 2.2.13 [Nov-27-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00664 (225 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|Q9Z0J1|RECK_MOUSE Reversion-inducing cysteine-rich prote... 32 0.34 sp|Q8N4J0|CI041_HUMAN Protein C9orf41 31 0.76 sp|O95980|RECK_HUMAN Reversion-inducing cysteine-rich prote... 30 1.3 sp|Q80UY1|CI041_MOUSE Protein C9orf41 homolog 29 2.9 sp|Q5BJZ6|CI041_RAT Protein C9orf41 homolog 29 3.8
>sp|Q9Z0J1|RECK_MOUSE Reversion-inducing cysteine-rich protein with Kazal motifs precursor (mRECK) Length = 971 Score = 32.3 bits (72), Expect = 0.34 Identities = 17/60 (28%), Positives = 26/60 (43%) Frame = +2 Query: 2 IKVVFIMFVVVAMLQADDEQEKYKACQKTYVKCIAGCRGAVPCSNQCTTEMEDCTGYEKG 181 IK+ FI V+ + E K AC C + RG++ C + C ++ C KG Sbjct: 390 IKMPFISIPVLDIKTCQPEMWKAVACSLQIKPCHSKSRGSIICKSDCVEILKKCGDQPKG 449
>sp|Q8N4J0|CI041_HUMAN Protein C9orf41 Length = 409 Score = 31.2 bits (69), Expect = 0.76 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -2 Query: 197 KQISVFLSHIQYNPPFRWCIDLNMELLLGILQYILHKFSGKPY 69 K + FL H+ R CID N E+LL I+ +H F K Y Sbjct: 100 KLLPQFLLHLD---KIRKCIDHNQEILLTIVNDCIHMFENKEY 139
>sp|O95980|RECK_HUMAN Reversion-inducing cysteine-rich protein with Kazal motifs precursor (hRECK) (Suppressor of tumorigenicity 15) (ST15) Length = 971 Score = 30.4 bits (67), Expect = 1.3 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = +2 Query: 2 IKVVFIMFVVVAMLQADDEQEKYKACQKTYVKCIAGCRGAVPCSNQCTTEMEDCTGYEK 178 IK+ FI V+ + + E K AC C + RG++ C + C ++ C K Sbjct: 390 IKMPFINIPVLDIKKCQPEMWKAIACSLQIKPCHSKSRGSIICKSDCVEILKKCGDQNK 448
>sp|Q80UY1|CI041_MOUSE Protein C9orf41 homolog Length = 400 Score = 29.3 bits (64), Expect = 2.9 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -2 Query: 149 RWCIDLNMELLLGILQYILHKFSGKPY 69 R CID N E+LL I+ +H F K Y Sbjct: 104 RKCIDHNQEILLTIVNDCIHMFENKEY 130
>sp|Q5BJZ6|CI041_RAT Protein C9orf41 homolog Length = 400 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 149 RWCIDLNMELLLGILQYILHKFSGKPY 69 R C+D N E+LL I+ +H F K Y Sbjct: 104 RKCVDHNQEILLTIVNDCIHMFENKEY 130
Database: Non-redundant SwissProt sequences
Posted date: Dec 6, 2005 7:40 AM
Number of letters in database: 68,354,980
Number of sequences in database: 184,735
Database: swissprot.01
Posted date: Dec 6, 2005 8:18 AM
Number of letters in database: 66,202,850
Number of sequences in database: 184,431
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,820,159
Number of Sequences: 369166
Number of extensions: 438716
Number of successful extensions: 1178
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1165
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1178
length of database: 68,354,980
effective HSP length: 46
effective length of database: 59,857,170
effective search space used: 1676000760
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
Cluster detail
