Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= DrC_00653 (549 letters) Database: Non-redundant SwissProt sequences 184,735 sequences; 68,354,980 total letters Score E Sequences producing significant alignments: (bits) Value sp|P38067|UGA2_YEAST Succinate-semialdehyde dehydrogenase [... 31 1.7 sp|Q7YR73|ICOS_CANFA Inducible T-cell co-stimulator precurs... 30 3.0
>sp|P38067|UGA2_YEAST Succinate-semialdehyde dehydrogenase [NADP+] (SSDH) Length = 497 Score = 31.2 bits (69), Expect = 1.7 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 225 LHDPAKLYEMNAINDKWIDGSDTVKTMEAVDPIEGTI 335 L+DP E I+ KW+ G+D V E VDP G I Sbjct: 11 LNDPNLFRESGYIDGKWVKGTDEV--FEVVDPASGEI 45
>sp|Q7YR73|ICOS_CANFA Inducible T-cell co-stimulator precursor (Activation-inducible lymphocyte immunomediatory molecule) Length = 208 Score = 30.4 bits (67), Expect = 3.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -2 Query: 467 CCNFNSFYIIGSIGFRCLSLHFCIGYCWLRIRNYRS 360 CC + IG F + + CI CWL + YRS Sbjct: 136 CCQLKFWLPIGCAAFVVVYIFGCIFLCWLTKKKYRS 171
  Database: Non-redundant SwissProt sequences
    Posted date:  Dec 6, 2005  7:40 AM
  Number of letters in database: 68,354,980
  Number of sequences in database:  184,735
  
  Database: swissprot.01
    Posted date:  Dec 6, 2005  8:18 AM
  Number of letters in database: 66,202,850
  Number of sequences in database:  184,431
  
Lambda     K      H
   0.318    0.134    0.401 
Gapped
Lambda     K      H
   0.267   0.0410    0.140 
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 39,161,974
Number of Sequences: 369166
Number of extensions: 582199
Number of successful extensions: 1366
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1350
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1364
length of database: 68,354,980
effective HSP length: 104
effective length of database: 49,142,540
effective search space used: 3833118120
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)